KEGG   Bordetella avium: BAV2302
Entry
BAV2302           CDS       T00695                                 

Definition
(GenBank) putative membrane protein
Organism
bav  Bordetella avium
SSDB
Motif
Pfam: TerC
Other DBs
NCBI-ProteinID: CAJ49912
UniProt: Q2KYG0
Position
complement(2482797..2483495)
AA seq 232 aa
MELSSAAFWIALLQIIWVNILLSGDNAVVIALAARSLPPHQQKKAIVVGSAAAIIMRIVL
TLVAAQLLLLPWLKLIGALLLVYIGVTLLLPEGDEDGAGKENGNLLTAIRTIMIADLVMS
LDNVVAVAAAAMGDTTLLVLGLAISIPLVIFGSTLLLKVIERFPLIVWVGAALLGFIAGE
LLVGDPALHDAVERIDAVLGVTQHQFALMCGAVGAVLVLAIGKFFLMRQQAD
NT seq 699 nt   +upstreamnt  +downstreamnt
atggaactcagttctgctgcattctggatcgcattgctccagatcatttgggtcaatatt
ctgctgtcgggcgacaacgccgtggtgatcgcgctcgcagcccgctcgctgccgccgcat
cagcagaaaaaagcgatcgtcgttggttcggccgcggcgatcatcatgcgtatcgtgctc
acgctcgtggcggcgcaactgctgttgctgccctggttgaagctgatcggcgcgctgttg
ctggtctatattggcgtcaccttgctgctgcccgagggggatgaagacggggctggcaaa
gagaacggcaacctgctcaccgcgatccgcaccatcatgattgccgacctcgtcatgagc
ctggacaacgtcgttgccgtcgctgcggcggccatgggcgacacgaccctgctggtgcta
ggcttggcgatcagtattccattggtgattttcggcagcaccctgttgctcaaggtcatc
gagcgctttccgcttatcgtctgggtgggcgccgcgcttcttggctttatcgcgggtgag
ttgctggttggcgatccggctctgcatgatgcggttgagcgtattgacgctgtcctgggc
gtaacgcaacatcaatttgccttgatgtgcggcgctgtcggagcagtgcttgttttggca
ataggaaagtttttcctcatgcgccagcaagctgactga

DBGET integrated database retrieval system