KEGG   Bordetella avium: BAV2304Help
Entry
BAV2304           CDS       T00695                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bav  Bordetella avium
Pathway
bav00020  Citrate cycle (TCA cycle)
bav00640  Propanoate metabolism
bav00660  C5-Branched dibasic acid metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01200  Carbon metabolism
Module
bav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAV2304 (sucC)
   00640 Propanoate metabolism
    BAV2304 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BAV2304 (sucC)
Enzymes [BR:bav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BAV2304 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAJ49914
UniProt: Q2KYF7
Position
complement(2484677..2485837)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKELLKQFGVPVPRGIPAFSVEEAVAAAEKLGGPVWVVKAQIHAGGRGKGGGV
KLARSLDEVRQLASQILGMQLVTHQTGAQGQKVNRLYIEDGADIQKEYYVSLVTDRGTQK
VALIASSEGGMDIEEVAHSTPEKIITEYIDPIVGLTDAQAKKVADAIGMPADSTAQAVDV
FKKLYQCYMDTDASLVEINPLNRDSKGNIIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNKGVKAILVNIFGGIMRCDVIAEGVISACKAVNLSVPLVVRMKGTNEELGKKM
LAESGLPIISADTMAEAATKVVAAAK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccacgagtatcaaggcaaggaattgctgaagcaatttggcgtcccagtgccg
cgcggtattcccgctttttccgtagaagaggctgtggcagctgccgagaagctgggcggc
ccggtctgggtcgtcaaggcgcagatccacgccggtggccgcggcaagggcggcggcgtg
aagttggcccgctcgctggatgaagtccgtcaactggcttcgcagatcctgggcatgcaa
ctggtcacgcaccagaccggcgcgcaaggccagaaggtcaaccgtctgtacatcgaagac
ggcgccgacatccagaaggaatactacgtttcgctggttaccgaccgtggcacccagaag
gttgccctgatcgcctcgagcgaaggcggcatggacatcgaagaggtggcgcactccacc
cccgagaagatcatcaccgagtacatcgacccgatcgttggcctgaccgacgctcaggcc
aagaaggtcgcggacgccatcggcatgcctgccgactcgaccgcccaggccgtggacgtg
ttcaagaagctgtatcagtgctacatggacaccgatgcttcgctggtcgaaatcaatccc
ctgaaccgcgacagcaagggcaatatcatcgcccttgacgccaagttcaactttgattcg
aacgcgctgttccgtcacccggaaatcgtggcctaccgcgatctggacgaagaagacccg
gcggaaatcgaagcctccaagtttgacctggcctatattcagctcgacggcaacatcggc
tgcctggtgaacggcgctggcctggccatggcgaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctggacgtcggcggcggcgccacggcagagaaggtgactgaa
gccttcaagatcatgctcaagaacaagggtgtgaaggcgatcctggtcaacattttcggc
ggcatcatgcgctgcgacgtcatcgccgaaggcgtgatctccgcgtgcaaggccgtcaac
ctcagcgtgccgctggttgtgcgcatgaagggcaccaacgaagaactcggcaagaagatg
ctcgccgagtccggcctgcccatcatcagcgccgacaccatggctgaagccgcgaccaaa
gtcgttgctgccgctaagtaa

DBGET integrated database retrieval system