KEGG   Bordetella avium: BAV2407Help
Entry
BAV2407           CDS       T00695                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
bav  Bordetella avium
Pathway
bav00380  Tryptophan metabolism
bav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BAV2407
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     BAV2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase IDO
Motif
Other DBs
NCBI-ProteinID: CAJ50017
UniProt: Q2KXW2
Position
2598372..2599211
Genome map
AA seq 279 aa AA seqDB search
MSKPEDIVHQENAQLDFRKDMTYGDYLDLDALLSAQHPMSPEHNEMLFIIQHQTSELWMK
LMLHELRAAIRQIRNDQLPPAFKMLARVSKIMEQLVHAWDVLATMTPPEYSALRPYLARS
SGFQSYQYREIEFALGNKNAAMLRPHAHRADLLAEVQAAYEAPSLYDEALRLLAREGLPI
PAGHLERDWTQPYQANPEVEAAWLTVYREPDRYWNLYQLGEKLTDLEDAFRLWRFRHVTT
VERVIGFKKGTGGTSGVGYLRKMLEVVLFPEIWTLRTDL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcccgaagacatcgtccaccaggaaaacgcccagctcgatttccgcaaagac
atgacctatggtgattatctggatcttgacgcgctcttgagcgcccagcatccgatgtcg
cccgaacacaacgagatgctgttcatcattcagcaccagaccagtgaactctggatgaag
ctgatgctgcatgaattgcgcgccgccatccgccagattcgcaacgatcaactgccacct
gccttcaaaatgctggcccgtgtgagcaaaatcatggagcagttggtccatgcctgggat
gtgctggccaccatgacgccgccggaatactcggcgctgcgcccctatctggcgcgctcc
agtgggtttcagagctatcaatatcgcgaaatcgagtttgccctgggcaacaagaacgcc
gccatgcttcgcccccacgcacaccgggccgacttgctggccgaagtgcaggccgcttac
gaagccccgtcgctctacgatgaagccctgcgcctgctcgctcgcgaagggctgcccatt
ccggccggccacctggaacgcgactggacccagccctatcaagccaacccggaggtcgag
gccgcgtggctgacggtttaccgtgagcccgatcgctactggaatctctaccaattgggc
gaaaaactgacggatctggaagacgccttccgcctgtggcgctttcgccacgtaaccacg
gtggaacgtgtcataggattcaaaaaggggacgggaggaacatcgggtgtcggctatctg
cgcaagatgctcgaggtggtgctgttcccggagatctggaccctgcgcaccgacctgtaa

DBGET integrated database retrieval system