KEGG   Bordetella avium: BAV2476Help
Entry
BAV2476           CDS       T00695                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bav  Bordetella avium
Pathway
bav00071  Fatty acid degradation
bav00072  Synthesis and degradation of ketone bodies
bav00280  Valine, leucine and isoleucine degradation
bav00310  Lysine degradation
bav00362  Benzoate degradation
bav00380  Tryptophan metabolism
bav00620  Pyruvate metabolism
bav00630  Glyoxylate and dicarboxylate metabolism
bav00640  Propanoate metabolism
bav00650  Butanoate metabolism
bav00900  Terpenoid backbone biosynthesis
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01200  Carbon metabolism
bav01212  Fatty acid metabolism
bav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAV2476
   00630 Glyoxylate and dicarboxylate metabolism
    BAV2476
   00640 Propanoate metabolism
    BAV2476
   00650 Butanoate metabolism
    BAV2476
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAV2476
   00072 Synthesis and degradation of ketone bodies
    BAV2476
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAV2476
   00310 Lysine degradation
    BAV2476
   00380 Tryptophan metabolism
    BAV2476
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAV2476
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAV2476
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAV2476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bav04147]
    BAV2476
Enzymes [BR:bav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAV2476
Exosome [BR:bav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAV2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAJ50086
UniProt: Q2KXJ2
Position
complement(2671400..2672581)
Genome map
AA seq 393 aa AA seqDB search
MKEVIIAAGVRTAIGDFGGALKDVTPCDLGTTVIREALNRAGVRGDEVGHVAVGHVINTE
ARDMYLSRVAAINAGIGKETPAFNVNRLCGSGLQAVVSAAQGIMLGDAEIAVAAGAESMS
RAPYIAPSQRWGARMGDSVMIDMMTGALTDPFGRMHMGVTAENVAARFGVSRADQDALAV
ESHRRASAAIAAGYFKDQIVPVTIKTRKGEVVFERDEHVRDDVTATDLGRLKPVFQKESG
TVTAGNASGLNDGAAALVLMERSVAERRGVKPLARLVAYAHAGVDPEIMGIGPVPATQAV
LKRAGLTVDQLDVIEANEAFAAQACAVTRELKLDPAKVNPNGSGISLGHPIGATGAIITV
KALYELQRVQGRYALVTMCIGGGQGIAAVFERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggtcatcattgccgcaggcgtgcgtaccgcaatcggagatttcgggggcgcg
ttgaaagacgtgacgccctgtgatctcggcacgaccgtaatccgggaagcgctcaaccgc
gccggtgtccggggagatgaggtcgggcatgtcgccgttggtcatgtgatcaacaccgaa
gcgcgtgatatgtatctgtcgcgcgtggctgcgatcaacgcgggcataggcaaggaaacg
ccggctttcaatgttaaccggctgtgtggttccggtctgcaggccgtcgtgtcggcagcg
caaggcattatgctgggcgacgccgaaatcgccgtggcggcaggtgccgagagtatgagc
cgtgcgccttatatcgctccttcccagcgctggggcgcgcgcatgggagatagcgtgatg
atcgatatgatgaccggtgcgctcaccgacccgttcggacgcatgcatatgggcgtgact
gccgagaatgtggcagcccgcttcggtgtcagccgcgccgaccaggatgcgctggcggtc
gagtcacatcgccgtgccagcgcggccatcgcagcaggctatttcaaggaccagattgtt
ccggtcacgatcaagacgcgtaagggtgaggtcgtctttgagcgggatgagcatgtgcgc
gacgacgtcacggctacagacctcggccgtctcaagccggtattccagaaagaaagtgga
acggtgacggcgggcaatgcttcgggcttgaacgatggcgccgccgcactggtgctgatg
gagcgcagcgtcgccgagcggcgcggcgtcaagccgctggcccggctggtggcttatgcc
catgccggtgtcgatccggaaatcatgggcattggcccggttcctgcgacacaggccgtg
ctaaagcgtgcaggcctgactgtggatcagcttgatgtgatcgaggccaatgaagcattc
gccgctcaggcctgtgccgtgacgcgcgaactcaagctcgacccggccaaggtcaatccc
aatggcagcggtatcagtctgggccaccccatcggtgcaactggcgccatcattactgtc
aaggcgctgtatgagttgcagcgggtgcagggccgctatgcgctggtgacgatgtgcatc
ggcggcggccaaggtatcgccgccgtgttcgagcgtctctga

DBGET integrated database retrieval system