KEGG   Bordetella avium: BAV3370Help
Entry
BAV3370           CDS       T00695                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bav  Bordetella avium
Pathway
bav00071  Fatty acid degradation
bav00072  Synthesis and degradation of ketone bodies
bav00280  Valine, leucine and isoleucine degradation
bav00310  Lysine degradation
bav00362  Benzoate degradation
bav00380  Tryptophan metabolism
bav00620  Pyruvate metabolism
bav00630  Glyoxylate and dicarboxylate metabolism
bav00640  Propanoate metabolism
bav00650  Butanoate metabolism
bav00900  Terpenoid backbone biosynthesis
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01200  Carbon metabolism
bav01212  Fatty acid metabolism
bav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAV3370
   00630 Glyoxylate and dicarboxylate metabolism
    BAV3370
   00640 Propanoate metabolism
    BAV3370
   00650 Butanoate metabolism
    BAV3370
  Lipid metabolism
   00071 Fatty acid degradation
    BAV3370
   00072 Synthesis and degradation of ketone bodies
    BAV3370
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAV3370
   00310 Lysine degradation
    BAV3370
   00380 Tryptophan metabolism
    BAV3370
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAV3370
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAV3370
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAV3370
Enzymes [BR:bav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAV3370
Exosome [BR:bav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAV3370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAJ50980
UniProt: Q2KTN0
Position
3657150..3658331
Genome map
AA seq 393 aa AA seqDB search
MSDPIVIVSVARTPMGSMLGSLSGLSAHELGAVAIKAAIERAGLKPEQVDEVIMGNVLQA
GQGQAPARQAALGAGLPLGVNCSTIHKVCGSGLKAAMFGHDLILAGSAEVVVAGGQESMS
NAPYLLLKGRQGYRYGHNTVYDHMALDGLEDAYDRGKAMGVFAEDCADKYHFSREQQDAY
SLESLRRARAATEDGSFKWEIAPVTVAGRKGDTVIDTDEAPTKAMPEKIPTLKPAFKKDG
TVTAANASSISDGAAAMVLMRASTAEKLGLKPLARIVAHSQHSQEPQWFTTAPVGALKKL
FEKTGWQASDVDLYEINEAFAVVTMAAMKELNLPHEKVNVHGGATALGHPIGASGARLVT
TLIGALRQNGGKKGVATLCIGGGEAVAMAIEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctatcgtcatcgtttccgttgcccgcaccccgatgggaagcatgctgggc
agcctgtccggcctgtccgcccatgaattgggcgccgtcgccatcaaggccgcgatcgag
cgcgccggcctcaagcccgagcaagtcgatgaagtcatcatgggcaacgtgctgcaagcc
gggcagggccaggcgccggcccgccaggctgccctgggcgcgggtttgccgctgggcgtg
aattgcagcaccatccacaaggtctgcggttcgggtctaaaggccgccatgttcggccat
gatctgattctggccggctcggccgaggtagtggtggcgggcggccaggaaagcatgagc
aacgcgccctatctgctgctcaagggccgtcagggctatcgctatggccacaataccgtg
tatgaccacatggccctcgatggtctggaagatgcctatgatcgcggcaaggccatgggc
gtattcgccgaagactgcgccgacaaataccacttcagccgcgaacaacaggacgcctat
tcgctggagtcgctgcgccgcgcgcgcgcagccactgaagacggcagcttcaaatgggaa
atcgcgccagtcaccgtggctggccgcaagggcgacaccgtgatcgacacggacgaagcc
cccaccaaggccatgccggagaagatccccaccctgaagcccgccttcaagaaagacggc
accgtcacggccgccaatgcttcgtcgatttccgacggcgccgccgccatggtgctgatg
cgcgcctccacggccgagaaactgggcctcaagcccctggcccgcatcgtcgcgcacagc
cagcattcgcaagagccgcagtggttcacgaccgctccggtaggcgcattgaaaaagctg
ttcgagaaaaccggctggcaggccagcgatgtcgatctgtacgaaatcaatgaagccttt
gccgtggtcaccatggccgccatgaaggaactcaatctgccgcatgaaaaagtcaatgtg
cacggcggcgccacggcgctgggccatcctatcggcgcctcgggcgcccgcctggtcacg
accctgatcggtgcgttgcgccagaacggcggcaagaagggcgttgccacgctgtgcatc
ggcggtggcgaagctgtggcaatggccatcgaaatgctctga

DBGET integrated database retrieval system