KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_00680Help
Entry
CWU_00680         CDS       T01826                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00450  Selenocompound metabolism
baw00970  Aminoacyl-tRNA biosynthesis
baw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CWU_00680
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CWU_00680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:baw01007]
    CWU_00680
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:baw03016]
    CWU_00680
Enzymes [BR:baw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CWU_00680
Amino acid related enzymes [BR:baw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CWU_00680
Transfer RNA biogenesis [BR:baw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CWU_00680
 Prokaryotic type
   Other AARSs
    CWU_00680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADP67655
Position
113994..115637
Genome map
AA seq 547 aa AA seqDB search
MSSVFRKILVTCALPYANGSIHIGHMLEHIQADIWVRYHRMRGHEVWFVSADDAHGTAIM
LKAQDLEISPNKLIKNIRIEHQIDFSNFKISHDNYYSTHSLENLYLSRKIFTCLNEKGLI
KEKKIFQLYDTVKKIFLPDRFIKGTCPICKSKNQYGDNCEICSATYEPTDLINPISVISG
KKPILKNTKHLYFDLPSFTNMLKKWIHSGVLEESVIKKTEEWFKVGLKSWAISRDAPYFG
FKIPNHPNKYFYVWLDAPIGYISAFKNLCFKSKKLNFNELWNQNSNYELYHFIGKDIIYF
HTLFWPAILEAVSFRQPSGIFVHGHLTMNGLKLSKSRGALIKASDWIQYFDSDSLRYYYA
SKLSNKTHDIEINLEDFIQKINSDIVNKLVNLAARNASFINKYFNGYLSDKLSNIKLYKY
FVNTSSSIEDFFENREFSFIVKESMRLLDIANQYINEKKPWKIKRTEENIRELQNICTMG
INLFRIIMIFLKPIVPDLAIKTESFLISKLTWDGIKKPLLSHQINKFFPLYKRIDVEKMF
EFMNICR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgtatttagaaaaattttagttacctgtgctttaccttatgctaatggttct
attcacattggccatatgttagaacatattcaagcagatatttgggtgcgttatcataga
atgcgtggtcacgaagtatggtttgtttctgctgatgatgcacatggtactgctataatg
ttaaaagctcaagatttagaaatatctcctaataaattaattaaaaatattaggatagag
catcaaatagatttttcgaattttaaaatttctcatgataattattattcaactcatagt
ttagaaaatttatatttatcaagaaaaatttttacatgtttaaatgaaaaaggtttaatt
aaagaaaaaaaaattttccaactttatgatacagtaaaaaaaatttttcttccagacaga
tttataaaaggtacatgcccaatttgtaaatcaaaaaatcaatatggtgataactgtgaa
atatgtagtgcaacttatgagcctacagatttaattaatccaatctctgttatttcagga
aaaaaacctattttaaaaaacactaaacatttatattttgatttaccttcttttactaat
atgttaaaaaaatggatacattctggtgttttagaagaatcagttattaaaaaaacagaa
gaatggtttaaagtaggtttaaagtcgtgggctatttctcgtgatgcaccttattttggt
tttaaaattccaaatcatcctaacaaatatttttatgtttggcttgatgctccgatcggt
tatattagtgcgtttaaaaatctttgttttaagagtaaaaaattaaattttaatgaactt
tggaaccaaaattctaattatgaattataccattttattggtaaagatattatttacttt
catactttattttggcctgcaatattagaagctgtttcttttagacagcctagtggaatt
tttgttcatggacatcttactatgaatggactgaaattgtcaaaatccagaggtgctttg
attaaagctagtgattggattcagtatttcgattccgatagtttgcgttattattatgca
agcaagttatctaataaaacccatgatattgaaattaatttagaagactttattcaaaaa
ataaatagtgatatcgtaaataaactagtaaatttagcagcaagaaatgccagttttatt
aataaatattttaatgggtatttatctgataaattaagcaatataaaattatataaatat
tttgttaatactagtagtagtattgaagatttttttgaaaatcgcgagtttagttttata
gttaaagaatcaatgagattattagatatagccaatcaatatattaatgaaaaaaaacca
tggaaaattaaaagaacagaagaaaatatcagggaattacaaaatatttgcacaatgggt
attaatttatttagaattataatgatttttttaaaacctatagtacctgatttagcaatc
aaaacagagtctttcttgatttctaaattgacttgggatggtattaaaaaaccattatta
tctcatcagataaataaattttttccattatataaaagaattgatgtcgaaaaaatgttt
gaattcatgaatatatgtagataa

DBGET integrated database retrieval system