KEGG   Bacillus anthracis H9401: H9401_1067Help
Entry
H9401_1067        CDS       T02028                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00620  Pyruvate metabolism
bax00630  Glyoxylate and dicarboxylate metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01200  Carbon metabolism
Module
bax_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H9401_1067
   00630 Glyoxylate and dicarboxylate metabolism
    H9401_1067
Enzymes [BR:bax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     H9401_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFH82453
Structure
PDB: 

Position
1095850..1097409
Genome map
AA seq 519 aa AA seqDB search
MGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEFPKFLEETKRI
READWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAIEGQ
INLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKNMSGSLVDFGL
YFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTIKATVLLETIH
ASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTMTAPFMRAYSL
KVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHDGTWVAHPGLV
PVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISVGIQYIASWLS
GRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELKEEELAKIERE
IGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgggagaaatgttaccagcgtacaacgaaatattgacacctgaggcgcttagtttttta
aaggaactacatgaaaattttaatgagcgccgcatagaacttttacaaaagcgtatgaaa
aaacaacagaaaattgatgcaggagagtttccgaagtttttagaagaaacaaagcgtata
cgtgaagcggattggacaattgctaaattgccaaaagatttagaggatcgccgcgtagag
attactggtccagtagatagaaagatggttattaacgctttaaattcgggagcacatctt
tttatggcggattttgaagattcgaattcaccaacttgggaaaatgcaattgaaggtcaa
ataaacttacgagatgcagtaaagggaacgatttcacataaaaatgaaaacggaaaagaa
tatcgtttaaatagtaaaacagctgtattaattgtgcgtccaaggggatggcatttagaa
gaaaaacatatgcaagttgacggaaaaaatatgtctggtagcttagtagatttcggactt
tattttttccataatgcgaaagctcttttagaaaaaggaagcggtccatacttttactta
ccgaaaatggaaagctatttagaagcaagattatggaatgatgttttcgtatttgctcaa
aaatatatcggtattccaaatggaacgatcaaagcaacggtgttactggaaacgattcac
gcttcgtttgaaatggatgaaattttgtatgagcttaaagatcattctgctggattaaat
tgcggaagatgggattatatttttagttttctaaaagctttccgtaatcataatgaattt
ttacttcctgatagagcgcaagtcacgatgacggcgccgtttatgcgcgcgtattctttg
aaagtcattcaaacttgtcaccgccgtaatgcaccagctattggagggatggcagcacaa
attccgattaaaaacaatcctgaagcgaatgaagctgcttttgaaaaagtgcgtgctgat
aaggagcgagaagctttagacggtcatgacgggacttgggttgcccacccgggacttgtg
ccagtcgcgatggaagtatttaatcacattatgaaaacaccgaatcaaatttttagaaaa
cgagaagaaatacatgttacagaaaaggatttattagaagtaccagtgggaacgattaca
gaagagggtcttcgtatgaatattagcgtaggcattcaatatatcgcatcttggttaagc
ggacggggagcagcaccaatttataacttaatggaagatgcggcaacagctgaaatctca
agagcacaagtatggcaatggattcgccatgaaggtggaaaattaaatgatggccgtaat
attacacttgaattaatggaagagttaaaagaagaagagttagcaaaaatagaaagagag
attggtaaagaagcctttaagaaagggagattccaagaggcgacaacgttgtttacaaat
ctcgttcggaatgatgaattcgtaccatttttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system