KEGG   Bacillus anthracis H9401: H9401_2153Help
Entry
H9401_2153        CDS       T02028                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-containing protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00071  Fatty acid degradation
bax00350  Tyrosine metabolism
bax00625  Chloroalkane and chloroalkene degradation
bax00626  Naphthalene degradation
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_2153
  Lipid metabolism
   00071 Fatty acid degradation
    H9401_2153
  Amino acid metabolism
   00350 Tyrosine metabolism
    H9401_2153
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H9401_2153
   00626 Naphthalene degradation
    H9401_2153
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H9401_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C TrkA_N Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AFH83539
Position
2102481..2103518
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVVEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIIQEEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKQNNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagccaatattgaggttgttgaaaaggaa
ttacgtccgctacactcaggtgaagcactagtagatgtagagtattgtggggtttgtcat
actgatttacacgttgcaaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtgtaggtattgtgacgaaaatcgctgatgatgttacttcactaaaggtaggtgat
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtgactggt
agagaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgttacagctgattatgcagtgaaagtaccagaaggattagatcctgct
caagcatcatcgatcacatgtgcgggcgttactacatataaagctataaaagtatctgat
attaaacctggtcaaccgatcgtaatctatggttgtggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ctagccttagcaaaagaggttggtgctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattattcaagaggagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaggtagcattcaactcagcagttgacgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaactatggatttgaacattccgcgccttgtactagatggaatt
gaagtagttggttctttagtcggtactcgtaaggatctagaagaggcgtttatgttcggg
gcagaaggaaaagtagtgccagttgttcaaacttgttctttagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaatcgattttaaacagaac
aattgtgattgcaaataa

DBGET integrated database retrieval system