KEGG   Bacillus anthracis H9401: H9401_2645Help
Entry
H9401_2645        CDS       T02028                                 

Definition
(GenBank) Dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00020  Citrate cycle (TCA cycle)
bax00620  Pyruvate metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
Module
bax_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_2645
   00020 Citrate cycle (TCA cycle)
    H9401_2645
   00620 Pyruvate metabolism
    H9401_2645
Enzymes [BR:bax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     H9401_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: AFH84031
Position
complement(2571173..2572243)
Genome map
AA seq 356 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTILDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKIAKTENLDIRALLGTGPGGRITKVDVLKALEERVAIPEVLEESKVLPVTGMR
KAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVVLA
LGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNAAQK
ARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttagggatggcgatgaaagagggtattattacg
agctggaatattaaagcgggtgataatgtggcaaaaggagaattaattgccagtattaac
tcggaaaaaattgaaacggaaatagaagcaccagctgatggaactattcttgatatagct
gtaagtgaagatgagggggttccacctggcactgtaatttgctacattggtaaaccgaat
gaaaaagtagaggtacatgaaagcacaaaggttgaggaagaactgacagcgagtgaagta
ccacaaaatgtacaacatccagaaccgttagggaaagaagttacgaataaacaaagaatc
aaaatatctcctgtagcgaagaagattgcgaaaactgaaaatcttgatattagagcatta
cttggtacaggtccaggtggaagaattacaaaggtagatgtattaaaggcacttgaagaa
agagtagcaattccagaagtacttgaagaaagtaaagtacttcctgttactggtatgcgg
aaagcaatcgcaaatcgtatgcatgcaagcttacaaaatagtgcgcaattaacattaacg
atgaaagtagatgtgacagatttagttgctttacataaagaaatagcggaagttgtacaa
aaacgatacgataacaaattaaccattacggatttcgtttctcgagctgttgtattagcg
cttggggagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaatttgaa
catgttcatttaggtatggcagtcgcattagaaaaaggattagtcgttccagctattcgc
ttcgcaaataatctctcattagtagagttatctaaagagattaagaatgcggcacaaaag
gcacgagcaggcaatttaaatagtgatgatatgcaaggaacaacatttacaattagtaat
ttaggaagcttcggtattgaatattttacacccgtattaaacacaccagaaactggtatt
ttaggtgtaggtgcaattgaacatgttcctgtatataaagggaaaaattaa

DBGET integrated database retrieval system