KEGG   Bacillus anthracis H9401: H9401_3692Help
Entry
H9401_3692        CDS       T02028                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00260  Glycine, serine and threonine metabolism
bax00680  Methane metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
bax01230  Biosynthesis of amino acids
Module
bax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bax_M00002  Glycolysis, core module involving three-carbon compounds
bax_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_3692
  Energy metabolism
   00680 Methane metabolism
    H9401_3692
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H9401_3692
Enzymes [BR:bax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     H9401_3692
Membrane trafficking [BR:bax04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    H9401_3692
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   H9401_3692
  Exosomal proteins of melanoma cells
   H9401_3692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF1482
Motif
Other DBs
NCBI-ProteinID: AFH85078
Position
complement(3536120..3536695)
Genome map
AA seq 191 aa AA seqDB search
MNTYIYMVRHGESPKLDGGERTRGLTEKGSLDVHKVTDILKTEGIDTFISSPYKRAVLTI
EKTANLYEREILIYENLKECMFSSGDQVISDKEVYPLVQKMFSNPGYALAEGESYADCQR
RVVKVLKEILMDFQGQKIVIGTHGLVMTLMMNYFDKQYGFEFLMNTSKPDIYKMEFKEKQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatatatttatatggttagacacggtgaatcaccaaaattagatgggggtgaa
agaacacgtggtttaactgaaaagggaagtttagacgttcataaagtaacagatatatta
aaaacagagggaatcgatactttcatttcaagtccgtataagagggctgtattaacgata
gaaaaaacagctaatctctatgaaagagaaatattaatatatgaaaaccttaaagagtgt
atgttttccagtggggatcaagttatatcagataaagaagtgtatccgcttgtacagaaa
atgttctctaatcctggctatgcactagcggaaggagagtcatatgcggattgccagaga
agagtagtgaaagtgttaaaagaaatattaatggattttcaaggacaaaaaattgtaatt
ggtacacatggtcttgtcatgacattaatgatgaactatttcgataaacaatatggtttt
gaatttttaatgaatacgtcaaaaccagatatatataagatggagtttaaagaaaaacaa
ttaatgaatgtagagagattatggaaagcggaataa

DBGET integrated database retrieval system