KEGG   Bacillus anthracis H9401: H9401_4150Help
Entry
H9401_4150        CDS       T02028                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00220  Arginine biosynthesis
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01130  Biosynthesis of antibiotics
bax01230  Biosynthesis of amino acids
Module
bax_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    H9401_4150
Enzymes [BR:bax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     H9401_4150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AFH85536
Structure
PDB: 

Position
complement(3961906..3962856)
Genome map
AA seq 316 aa AA seqDB search
MSTVQVPKLNTKDLLTLEELTQEEIISLIEFAIYLKKNKQEPLLQGKILGLIFDKHSTRT
RVSFEAGMVQLGGHGMFLNGKEMQMGRGETVSDTAKVLSHYIDGIMIRTFSHADVEELAK
ESSIPVINGLTDDHHPCQALADLMTIYEETNTFKGIKLAYVGDGNNVCHSLLLASAKVGM
HMTVATPVGYKPNEEIVKKALAIAKETGAEIEILHNPELAVNEADFIYTDVWMSMGQEGE
EEKYTLFQPYQINKELVKHAKQTYHFLHCLPAHREEEVTGEIIDGPQSIVFEQAGNRLHA
QKALLVSLFKNVEELS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgtacaagtaccgaagttaaatacgaaagatcttttaacactagaagaatta
acgcaagaagaaatcatttctttaattgagttcgctatatatttaaaaaagaataagcag
gagcctttattacaaggaaagatattagggcttatctttgataaacattcaactcgtact
cgcgtatcttttgaagcaggaatggtacagcttgggggacatggaatgtttttaaatgga
aaggagatgcaaatgggaagaggggagaccgtttcagatactgcaaaagtattgtctcat
tatattgacgggatcatgatacgcacattctcgcacgcggatgtagaagagcttgcaaaa
gaatcgagcattcctgttattaatggactaacagatgaccatcatccttgtcaagcattg
gcagacttaatgacaatatatgaagaaacaaatacattcaaaggaataaaattggcttac
gtaggtgacggaaataatgtatgtcattcattgttgttagcgagtgcgaaagtcggaatg
catatgactgttgcaacgcctgtagggtataaaccgaatgaagagattgtaaaaaaagcg
ttagcgattgccaaggaaacaggagctgaaattgagattttgcataaccctgaattagcg
gtgaatgaagcagatttcatttatactgacgtttggatgagcatggggcaagagggagaa
gaagagaaatatactttattccaaccatatcaaattaataaagaacttgttaagcatgcg
aaacaaacatatcatttcttacactgtttacctgcccatcgtgaagaggaagtaacaggc
gagattatagatggaccacagtctatcgtttttgagcaagctggtaatcgattgcatgcg
caaaaagcattattagtaagtttatttaaaaatgtagaagagctttcctaa

DBGET integrated database retrieval system