KEGG   Bacillus anthracis H9401: H9401_4196Help
Entry
H9401_4196        CDS       T02028                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00900  Terpenoid backbone biosynthesis
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
Module
bax_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:bax00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H9401_4196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bax01006]
    H9401_4196
Enzymes [BR:bax01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     H9401_4196
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     H9401_4196
    2.5.1.29  geranylgeranyl diphosphate synthase
     H9401_4196
Prenyltransferases [BR:bax01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   H9401_4196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt Hpr_kinase_C UbiA
Motif
Other DBs
NCBI-ProteinID: AFH85582
Position
complement(4007356..4008246)
Genome map
AA seq 296 aa AA seqDB search
MTIAFDTFLKESKTFVEEKLVSYANELQCPNVLREAMAYSLEAGGKRLRPLLLFATLQAF
DKERNLGVGAACALEMIHTYSLVHDDLPCMDDDDLRRGKPTNHKVFGEAMAVLAGDGLLT
YAFQVIMAYGQKEISAEKKVRLVLELAKAAGPEGMVGGQVADMEAEGKQLTIDELEYIHK
HKTGKLLEFAVLAGSILSDATEEQEEKLLEFAKYIGLAFQIRDDILDVEGTEEEIGKPIG
SDVSNEKSTYTTLFTVDRAKDILDETIAKAKDAIGSLQLQDEYLLSICDLIAKRNN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgacaattgcttttgatacttttttaaaagaaagtaaaacttttgtagaagagaagctt
gtaagctatgcaaatgaattacaatgtccaaatgtacttcgtgaagcgatggcatattct
ttggaagcgggtggaaagcgtctccgcccgttacttttatttgcaacattacaagcgttt
gataaagaaagaaatcttggagtaggtgcagcttgtgctcttgaaatgatacatacatac
tcgttagttcatgatgatttaccttgtatggatgatgatgatttaagaagaggaaagccc
acaaatcataaagtatttggtgaagcgatggcagttttagcaggtgatggtttattaacg
tatgcttttcaagttattatggcatatggacaaaaggaaatctctgctgagaaaaaagta
agacttgtacttgagcttgcaaaagcggcagggccagagggaatggttggcggacaagtg
gcagatatggaagcggaagggaaacagcttacgatcgatgagctagagtatattcataag
cataagactgggaaactacttgaattcgctgtacttgcaggatcgatactttctgatgcc
acagaagaacaagaagaaaaattacttgagtttgcaaaatatatcggcttagctttccaa
attcgagatgatattttagatgtggaaggaaccgaagaagagattggaaaaccgattggt
agtgatgtttccaacgaaaagagcacatatacaacgttgtttactgtagatagagcaaag
gatattttagatgaaactattgcaaaagcaaaagatgctattggttccttgcaattacaa
gatgaatatttactatctatttgcgatttgattgcaaaacgtaataactaa

DBGET integrated database retrieval system