KEGG   Bacillus anthracis H9401: H9401_4284Help
Entry
H9401_4284        CDS       T02028                                 

Definition
(GenBank) Nucleoside-diphosphate-sugar pyrophosphorylase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00051  Fructose and mannose metabolism
bax00520  Amino sugar and nucleotide sugar metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    H9401_4284
   00520 Amino sugar and nucleotide sugar metabolism
    H9401_4284
Enzymes [BR:bax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     H9401_4284
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     H9401_4284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep PGM_PMM_I PGM_PMM_II YbaJ
Motif
Other DBs
NCBI-ProteinID: AFH85670
Position
complement(4072914..4075268)
Genome map
AA seq 784 aa AA seqDB search
MKGVILAGGKGRRLRPLTCNTPKPMLPLLEKPVLEYNIELLRQHGIREIAITVQYMSTAI
KQYFGDGSKWGVNLYYFEDSPPLGTAGSIKQAEKFLDETFVVISGDALTDFQLSKGITFH
EQQKRMVTMFVKEVENPLSFGLVVMNKEQEVTRYIEKPSWNEVVSNIVNTGIYIMEPEIF
SYIPPREFFDFSQDVFPLLANKNALFAYLSEGYWLDIGTFDQYRQAQFDLLTKKLQVPIP
YTEVLPMVWMGEGVTIGKGTKIHGPSFIGEGAKIGAGAVIEPYSIIGKNSIVSSYSHLQK
SIVFANAHIGQYCELLETTIGEHTMVEDDVTLFQKSIVADHCHIGKSTVIKQKGKLWPYK
AIDSYSVVGSAGVQESEKSAGWLQKSRIVGRGNVEITPQFIVKVAMAYGSLFTKGESILI
GSQEHIETTSYKNLFLHAIHGIGIHTMECKEMNESLFQYSIQDLQCAGGVFIQVENEKEV
IIKLYAQDGAQLTYKQQKAIEQVYMSESFYYVCEKEMGRNKLVHVSLHDYIEAVLERIDI
EKIQKQKFHLLINKRNDMLQHLLMLFLQRLGCTVTWIYAGEQKDHVKALMKSSKANMALM
FSEQGNYFELYDNHSNIYQGTDFEEVDIPDLLLESTGNIYLMSLKLGECYLLFYTQDEKK
SFQARWKRDILYRIGKLFELIALQGKTFLSIVEQSPPLYLLCDEVVCSWNEKGKVMRKLL
ADMERKEEGIFEGVQFKYTEKEWSYIVSDTKQPKFLVYSHARNPVIARENMKNLIEKIRQ
YQKV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggttattttagctggaggaaaaggacgacgccttagaccattaacatgtaat
actccaaagccgatgttgccattattagaaaagccagttttggaatacaatattgaatta
ttgcgtcagcatggtatacgtgagattgcaattactgttcagtatatgagtacggccatt
aagcaatattttggtgacggtagcaaatggggcgttaacttgtactactttgaagactct
ccaccgcttggaactgcagggagtattaaacaagcggaaaaatttttggatgaaacgttt
gtggtcataagtggggatgcgttaactgattttcaattatcaaaaggaattacgtttcat
gaacaacagaaaagaatggtaactatgtttgtaaaggaagtagaaaatccactctcattc
ggtctagttgtaatgaacaaagaacaagaggttacacgatatatagaaaaaccgagttgg
aatgaagtagtctctaatattgtgaatacaggtatatatattatggagccagaaattttt
tcttacataccgccccgagaattttttgatttcagtcaagatgtgtttccattattggca
aataaaaacgcgttatttgcatatttatcagaaggttattggttagatatcggtacattt
gatcaataccgacaagcccaatttgatttgttaacaaaaaaattgcaagtacctattcct
tatactgaagtattgccgatggtatggatgggggaaggtgtgacgattggaaaaggcaca
aaaattcacggcccttcttttattggagagggagcaaaaattggtgccggggctgtaatt
gagccgtactctattatcgggaaaaatagtattgtttcgagttattctcatcttcaaaaa
agtattgtttttgcaaatgcgcacattggacaatattgcgagttattagaaacgacaata
ggagagcatacaatggtggaagatgacgttacattgtttcaaaaaagcattgtagcagat
cattgtcatatagggaaaagtacggtaattaagcaaaagggaaaactatggccatataag
gcgattgatagctattcggtagtaggatcggctggtgttcaagaaagtgaaaagagcgcc
ggatggctgcaaaaaagtcgcattgtaggaagagggaacgttgaaatcacccctcaattt
atagtaaaggtagcgatggcgtacggatccctttttaccaaaggggaaagtatattaatc
gggagccaagaacatatagaaacgacttcttataaaaatctttttcttcatgcgattcat
ggtattgggattcatacgatggaatgcaaagaaatgaacgaatcgctttttcagtatagc
attcaagatttacaatgtgcaggtggagttttcattcaagtggaaaatgaaaaagaagtt
attataaagttgtatgctcaggatggggcacaattaacgtataagcagcaaaaagcgata
gaacaagtatatatgtctgagtctttttattacgtatgtgagaaagaaatgggacgaaat
aagctggtccatgtttctttacatgattatatagaggctgtgttagagcgcattgatatt
gagaaaatacaaaaacagaagttccaccttcttattaataagagaaatgatatgttacaa
catttacttatgctttttttgcaaaggcttggatgcacagttacgtggatttatgcaggt
gaacagaaggatcatgtgaaggccttgatgaaatcaagtaaagcgaatatggcactcatg
ttttcagagcaaggaaattattttgagttatatgataatcatagtaacatttaccagggg
acagattttgaagaggtagatattccagatttattacttgaatcgacaggaaatatttac
ctaatgtctttgaaattaggagaatgttaccttctattttatacgcaggatgaaaaaaag
tcgtttcaagcgagatggaagcgagatatcctatatcgaattggaaaattatttgagcta
atagcattgcagggaaaaacatttctcagcatagtagagcaatcacctccgctctattta
ctttgtgatgaagttgtatgttcatggaatgaaaaagggaaagtgatgaggaaattattg
gctgatatggaaagaaaggaagaaggtatatttgaaggagtacagttcaaatataccgaa
aaagagtggtcttatatcgtttctgacacaaaacaaccgaaatttttagtgtattcacat
gctagaaacccagtcatagcaagggaaaacatgaaaaatcttatagaaaaaattagacaa
tatcaaaaggtgtag

DBGET integrated database retrieval system