KEGG   Bacillus anthracis H9401: H9401_4437Help
Entry
H9401_4437        CDS       T02028                                 

Definition
(GenBank) Holliday junction ATP-dependent DNA helicase ruvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bax  Bacillus anthracis H9401
Pathway
bax03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bax00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    H9401_4437
Enzymes [BR:bax01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     H9401_4437
DNA repair and recombination proteins [BR:bax03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     H9401_4437
    RecFOR pathway proteins
     H9401_4437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C WIYLD HHH 5_3_exonuc PG_binding_2 ADSL_C IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AFH85823
Position
complement(4217996..4218589)
Genome map
AA seq 197 aa AA seqDB search
MEYVGPEYVVIDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYGFKTREERL
LFTKLLGVSGIGPKGALAILASGQTGQVVQAIEHEDEKFLVKFPGVGKKTARQMILDLKG
KLADVVPDAFVDLFSDEERFDEKKGSSAELDEALEALRALGYAEREVSRVVPELLKESLT
TDQYIKKALSLLLNGKR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggagtatgtaggaccggaatatgtcgtaattgatcataatggaattggttatcaaatt
ttcacaccgaatccgtatgtatttcaaagaagtaagcaagaaatccgtgtctatacatat
cattatgtgagagaagatattatggcactttacgggtttaaaacacgtgaagagcgttta
ttatttacaaagttgttaggggtgtctggtattggaccaaaaggtgctcttgcaatttta
gcttctggtcaaacaggacaggtcgttcaagcgattgaacatgaagacgagaagttttta
gtgaagttcccgggcgtcggaaagaaaacagcacgccaaatgattttagatttaaaagga
aaactagcagacgttgtaccagatgcatttgttgatttattctcagacgaagaacgtttt
gatgagaagaaaggttcgtcagctgagcttgatgaggcgctggaagctctgcgcgcactt
ggatacgcagaacgagaagtttctcgcgttgtaccagagttattaaaagaatcattaacg
acggatcagtatattaaaaaggcacttagtcttttactaaatggtaagaggtga

DBGET integrated database retrieval system