KEGG   Bacillus anthracis H9401: H9401_5117Help
Entry
H9401_5117        CDS       T02028                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00051  Fructose and mannose metabolism
bax00562  Inositol phosphate metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
bax01230  Biosynthesis of amino acids
Module
bax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bax_M00002  Glycolysis, core module involving three-carbon compounds
bax_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_5117
   00051 Fructose and mannose metabolism
    H9401_5117
   00562 Inositol phosphate metabolism
    H9401_5117
Enzymes [BR:bax01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     H9401_5117
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   H9401_5117
  Exosomal proteins of bladder cancer cells
   H9401_5117
  Exosomal proteins of melanoma cells
   H9401_5117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFH86503
Position
complement(4852679..4853434)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEVVSPAAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgcctggtagcagcgactgaaggaactgatttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactattgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagttgtttctcca
gctgctgcagaagctgttcgtatccaatacggcggtagcgtaaaaccagaaaacattaaa
gagtacatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system