KEGG   Bacillus anthracis H9401: H9401_5330Help
Entry
H9401_5330        CDS       T02028                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00071  Fatty acid degradation
bax00072  Synthesis and degradation of ketone bodies
bax00280  Valine, leucine and isoleucine degradation
bax00310  Lysine degradation
bax00362  Benzoate degradation
bax00380  Tryptophan metabolism
bax00620  Pyruvate metabolism
bax00630  Glyoxylate and dicarboxylate metabolism
bax00640  Propanoate metabolism
bax00650  Butanoate metabolism
bax00900  Terpenoid backbone biosynthesis
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
bax01212  Fatty acid metabolism
bax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H9401_5330
   00630 Glyoxylate and dicarboxylate metabolism
    H9401_5330
   00640 Propanoate metabolism
    H9401_5330
   00650 Butanoate metabolism
    H9401_5330
  Lipid metabolism
   00071 Fatty acid degradation
    H9401_5330
   00072 Synthesis and degradation of ketone bodies
    H9401_5330
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H9401_5330
   00310 Lysine degradation
    H9401_5330
   00380 Tryptophan metabolism
    H9401_5330
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H9401_5330
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H9401_5330
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H9401_5330
Enzymes [BR:bax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H9401_5330
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H9401_5330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFH86714
Position
complement(5063798..5064994)
Genome map
AA seq 398 aa AA seqDB search
MGERNMSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGT
VIQGGQGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGM
ESMSNSPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQ
DEWAYRSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPV
FDKTATVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGY
AINALLEKTGKKIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASG
ARIIVTLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaagaaacatgagtaaaacagttattttaagtgctgcaagaacaccggtgggg
aaatttggaggatctttaaaagatgtaaaagcaacagaacttggaggaatcgcaattaaa
gcagcgcttgaaagagcgaatgtttcagctagtgatgttgaggaagttatattcggaacg
gttattcaaggtggacagggacaaattccatcacgccaagctgcaagggctgctggaatc
ccttgggaagtgcagacggaaactgtcaataaagtttgtgcatcagggcttcgtgcggtg
actttagcggatcaaattattcgtactggcgatcaatcactaattgtagctggtggtatg
gagtcgatgagtaacagtccttacattttacgaggagcaagatggggatacagaatgggt
aacaacgaagtcattgatttaaacgttgctgacggtttaacatgcgcattttcaggtata
cacatgggtgtttatggcggagaagttgcgaaggaggatggaatttctcgcgaagcgcaa
gatgaatgggcatatcgtagccatcagcgtgcagtttcagcgcataaagaaggacgtttt
gaagaggaaatcgtgccagtaacgattccacaaagaaaaggcgatcctattgtcgttgca
aaggatgaggcgccgcgtgaagatacaacaattgaaaaactagcaaaattaaaacctgta
tttgataagacagcgacggtgacagctggtaatgcaccagggctaaacgatggtggcgct
gcacttgtattaatgagcgaagacagagcgaagcaagaaggaagaaagccgttagcgaca
attttggcacatacagcaattgcagtggagtctaaagatttcccgaggacgccaggttat
gcaattaacgcattgcttgaaaaaacaggaaagaaaattgaagacatcgatttatttgag
attaatgaagcatttgcagcggtagcaattgcaagtacagaaatcgcaggaattgaccca
gaaaaattgaatgtaaatggcggcgcagtggcgatgggacatccgattggagcaagcgga
gcgcgcattatcgttacactaatccatgcacttaagcaacgcggcggtggaattggaatt
gcttcgatttgtagtggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system