KEGG   Bacillus velezensis FZB42: RBAM_004250Help
Entry
RBAM_004250       CDS       T00582                                 

Gene name
mtlD
Definition
(GenBank) MtlD
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00051  Fructose and mannose metabolism
bay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RBAM_004250 (mtlD)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     RBAM_004250 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABS72824
UniProt: A7Z1E8
Position
422893..424014
Genome map
AA seq 373 aa AA seqDB search
MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNEKKEYTVELADGGRQTEII
GPVSAINSAVQEQKLYRLINEAAIITTAVGPNVLRLIAPSIAEGLKRRTSSEPLNIIACE
NMIGGSSFLKKAVFGHLTEAERELVNRTVGFPDSAVDRIVPIQHHEDPLKVSVEPFFEWV
IDRTGFAGGQPVLKGALFTDDLTPFIERKLFTVNTGHAVTAYVGYQRGLKTVKEAIGHPE
IRRVVYDALSETGEYLVKAYGFKQSEHEQYMKKIIGRFENEYITDDVTRVARSPLRKLGA
NDRLVGPAKKIKEPNALAEGIAAALRFDYQDDPEAVELQKLIAEKGTSRVLQDICGIQLH
EPLHGIVLKKLNQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccttcatttcggagcgggaaacatcgggcggggctttatcggcgccctgctc
catcattccggctatgacgtagttttcgctgatgtgaatgaaacgatggtcagccttctc
aatgaaaagaaggaatataccgtggagcttgccgacggcggccggcagaccgaaatcatc
ggccccgtttcagccatcaacagcgcggtgcaagaacaaaagctgtacaggctgatcaat
gaggcggcgatcattacgacggcggtgggcccgaacgttctcagactcatcgccccgtcc
atcgcggaagggctgaagcgcagaacgtcctctgagcctctcaatatcattgcctgtgaa
aatatgatcggcggcagcagttttctgaaaaaagcagttttcggacatttgacggaagcg
gagcgggaactcgtgaaccggacggtcggcttcccggattctgcggtggatcggatcgtg
ccgattcagcaccatgaagatccgctgaaagtatccgtagaaccgttttttgaatgggtc
atagacagaaccggctttgccggcggccagccggtacttaaaggcgcgttgtttacggat
gatcttacgcctttcatcgagagaaagctgtttaccgtcaataccggtcatgccgttacg
gcgtacgtcggctatcagcgcggattaaaaaccgtcaaagaggccatcggccatccggaa
atccggcgtgtcgtgtacgatgcactttcagaaacgggcgagtacttagtgaaagcgtac
ggctttaagcaatccgaacacgagcagtacatgaaaaaaatcatcggccgctttgaaaat
gaatacatcacggatgatgtgacaagagtcgccagatcaccgctcagaaaactcggagcg
aatgatagattagtagggccggccaaaaaaataaaagaaccgaacgcgctggcagaaggc
atcgccgccgccctgcgctttgactatcaggatgatccggaagcggttgagctgcaaaag
cttatcgcggaaaaaggcacgagccgcgttcttcaagacatttgcggtattcagctgcat
gaaccgctgcacggcatcgtgctcaaaaagctcaatcaataa

DBGET integrated database retrieval system