KEGG   Bacillus velezensis FZB42: RBAM_007160Help
Entry
RBAM_007160       CDS       T00582                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
bay  Bacillus velezensis FZB42
Brite
KEGG Orthology (KO) [BR:bay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bay02048]
    RBAM_007160
Enzymes [BR:bay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     RBAM_007160
Prokaryotic defense system [BR:bay02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   RBAM_007160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3387 SWI2_SNF2 HSDR_N ResIII DUF87 DUF2075 DUF2959 MA3
Motif
Other DBs
NCBI-ProteinID: ABS73101
UniProt: A7Z275
Position
702216..705368
Genome map
AA seq 1050 aa AA seqDB search
MKFSEKSLEQAVIELFESESYSHQSGTGIQKEISDVLLRDDLKAFLLNRYSDDNITPNEI
DNIMRQMEVLPASNLYESNKAIIKMISDGFILKREDRSKKDLFIQLIDFAPNNIDNNLFR
IVNQLEIQGFKKCIPDVIVYVNGLPLVVIEFKSAIKENTTIKDAYTQLTVRYQRDIPELF
KYNTFCVISDGVNNKAGSLFAPYDFFYAWRKIEGKESFEKDGIDSLYSMVKGLFNQKRFL
EVVRHFIYFPDTSSKKEKIVPRYPQYYAATKLLKSIKRNMRPQGSGKGGTYFGATGSGKS
YTMLYLTRLLMRDKDLQSPTVVLISDRTDLDDQLAGQFTNAKYFIGDDQVISVESREDLK
SYLQNRKSGGVFLTTIQKFNENVDLLTDRNNVICISDEAHRSQTNLDQKIKITKDGVEKK
YGFAKHLHKSLPNATYIGFTGTPVDATLDVFGEVEDAYTMIEAVYDEITVRIVYEGRAAK
VNLNETKLHEIEEYYKVCETAGANEYQIDESKRAVTQMEVILGDPKRLKLVAEDFVEHYE
KRIEEGATIKGKAMFVAANRHIAYDLYKEIIALRPEWAEVRVCDEGVELTDKEKKEIKPM
EKIKMVMTRTKDDSKELYDLLGTKEYRKELDRQFKNEKSNFKIAIVVDMWLTGFDVPSLD
TIYIDKPIQQHTLIQTISRVNRIYEGKETGLVVDYFGIKSNLNVAMKKYGVVEGENFNGI
DKAVVIVKDQLDLLAKIFYKFDNTAYFHGTPLQQLQCLNQAAEFVQQTEQLEKRFMAITK
KLRSAYNLCVSSENISQMERDYIHYYLAIRSIIHKLTKGDAPDTAQMNEKVRQMMEEALI
SEGVEEVFKLDKNDSKNNADLFSDEYLAKINKIKLPNTKIKLLQKLLSKAIEEFKKTNKI
QGVDFSKRFKKLLEQYNERKDFQALQSDVLDDVAEQFADLFGELMNERDSFKDLGIDYEE
KAFYDILKAISEKHEFEYPHGKLIKLSQEIKSIIADKARYTDWSSRDDIKAELKVDLILT
LAENDYPPVPKDEIFKEIFEQAENFKKYRA
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattctctgaaaagtccttagagcaagccgtaatagaactttttgaaagtgaaagc
tattcacaccaaagcggaacgggcattcagaaggaaataagtgatgtacttctacgcgat
gatttaaaagcatttttacttaatcgctactcagatgataacattacgccgaatgagatt
gacaatatcatgcgacagatggaagtattacctgcatcgaatttatacgaaagtaacaaa
gctattatcaaaatgatttcagatggttttattctaaaacgagaagaccgaagtaaaaag
gatttatttattcaattaatagattttgctcctaataatatcgacaataatctatttaga
atagtaaatcaactagagatacaagggtttaaaaagtgtattccagatgtaattgtttat
gtaaatggcttacctttagtagtgatagagttcaaaagtgctatcaaagaaaatacgact
ataaaagatgcctatacacaactgactgttcgttaccagagggatatccctgagcttttt
aagtataatacattttgtgttattagtgatggagtaaataataaggctggttcgttattt
gctccctatgatttcttttatgcatggcgaaaaatagaaggtaaggaatcgtttgaaaag
gatggcattgattcactttattcaatggtgaagggtctatttaaccaaaaacgtttccta
gaagtggtacgtcacttcatttatttccctgatacaagcagcaaaaaagaaaaaattgtt
cctcgttatccacaatattatgccgcaacaaaattattaaaaagcattaaaagaaatatg
cggccgcaaggttcaggtaagggtggtacgtattttggagcaacaggttcaggcaagagt
tataccatgctatatcttacaagacttttaatgagagataaagacctacaaagccctact
gttgtcttgatatcagatagaacagatttagatgatcaacttgcaggacaattcacaaat
gctaagtattttataggcgatgaccaagtaataagtgtggaaagtcgggaagatttaaag
tcatacctacaaaatagaaaaagtggtggcgtatttttaactactattcaaaagtttaat
gaaaatgttgatctgctgacagatagaaacaatgtaatttgtatttcggacgaagcacat
cgttcgcaaacaaatcttgaccaaaaaataaaaatcactaaagatggtgtcgagaaaaaa
tatggttttgccaagcatttgcacaaatctctgcctaatgcaacttatattggttttact
ggtacaccggtggatgcaactttagatgtatttggggaagtagaagatgcatacacaatg
attgaagctgtatacgatgaaataactgtacggattgtttatgagggaagagctgctaaa
gtaaatctcaatgaaacaaaattgcatgaaatcgaagaatactataaagtgtgcgaaact
gctggagctaatgagtatcagattgatgaaagtaaaagagcagtaacccaaatggaagtt
attcttggtgatcctaaacggttaaaattagtggctgaagattttgtagagcattatgaa
aagagaattgaagaaggtgcaacaataaaaggtaaggcaatgtttgtagctgccaaccga
catattgcttatgacttgtataaagaaattattgcactacgtccagagtgggcagaagtt
agagtctgtgacgaaggtgttgagcttactgataaagaaaaaaaagaaattaaaccaatg
gaaaaaattaaaatggtcatgactcgtactaaagatgatagtaaagaactttatgacctg
ttaggtacgaaagaatatcgtaaagagttagataggcaattcaaaaatgaaaaatcaaac
ttcaaaatagccatcgttgttgatatgtggctaacaggatttgatgtaccatcactagat
accatatatattgataaaccaattcagcagcacaccctgattcagactatttcacgagta
aacagaatttatgaaggtaaagaaactggattagttgtcgattattttggaataaagagc
aatttaaatgtagcgatgaaaaaatatggtgttgtagagggggaaaattttaatggtatc
gataaggcagttgtcattgtaaaggatcagctagatttattagcaaaaatcttttataaa
tttgataatactgcatattttcacggaactccattgcaacaattacaatgcttaaatcaa
gcagcagaatttgtacaacaaacggagcaattagaaaaacgttttatggccataacgaag
aaacttcgctctgcctacaatttatgtgtgtctagtgaaaatataagccaaatggaaaga
gattatattcactattacctagctataaggtccatcatccataaactaacaaaaggtgat
gctccggatactgctcaaatgaatgaaaaagtaagacagatgatggaagaagctttaata
agtgaaggagtggaagaagtatttaagcttgataaaaatgattcgaaaaataatgcggat
ttatttagtgacgaatacttagctaagattaataaaatcaaactaccaaacactaaaatt
aagcttctacaaaaactactgtcaaaagcaattgaggaatttaaaaaaaccaataaaatt
cagggtgtcgacttttcaaaaagatttaaaaaattgcttgaacaatataatgaaagaaaa
gacttccaagctttgcaaagtgatgttttggatgatgttgcagaacaatttgcggatttg
tttggagaactaatgaacgagcgggattctttcaaggatttaggaattgattatgaggag
aaggctttctacgatattctcaaagcaatatcggagaaacatgaatttgaatacccgcac
ggcaaacttattaagctatcacaagaaataaagtctatcatcgcggataaagcaagatat
acagactggtcgagtagagatgatattaaggcagagctaaaagtcgatcttattttaacg
cttgctgaaaacgattaccctcctgttcctaaagatgagatttttaaagagatatttgaa
caggcagagaattttaagaagtatagggcgtaa

DBGET integrated database retrieval system