KEGG   Bacillus velezensis FZB42: RBAM_008320Help
Entry
RBAM_008320       CDS       T00582                                 

Gene name
acoC
Definition
(GenBank) AcoC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00010  Glycolysis / Gluconeogenesis
bay00020  Citrate cycle (TCA cycle)
bay00620  Pyruvate metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
bay01200  Carbon metabolism
Module
bay_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBAM_008320 (acoC)
   00020 Citrate cycle (TCA cycle)
    RBAM_008320 (acoC)
   00620 Pyruvate metabolism
    RBAM_008320 (acoC)
Enzymes [BR:bay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RBAM_008320 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N PYNP_C HlyD_D23 GCV_H EF_TS
Motif
Other DBs
NCBI-ProteinID: ABS73216
UniProt: A7Z2J0
Position
822036..823229
Genome map
AA seq 397 aa AA seqDB search
MAVKVVMPKLGMAMKKGEVSVWNKKVGDPVEKGESIASINSEKIEMEIEAPESGTLLHIK
VKEGEGVPPGTPICYIGENGEEVLEKEAPAPENAGKPQSEPEHIPAPKAVQKRKHRVKIS
PVARKMAEKAGLKVETLNGTGPGGRIVKADVIKAMKTEAEPQSSVQTAQPEEKPASAMRK
VIADRMHKSLQNSAQLTLTMKADITELVKWQEQLADSAKKRSGVKLTVTHFVSRAAVLAL
KQHPELNSSYQEERIITYPYVHLGMAVSLENGLVVPVIRDAEKLSFLELADHISTSARRA
REGNASGDDLHGSTFSITNLGGYGIEHFTPILNPPEAGILGVGASYETPAFKGDELVKST
MLPLSLTFDHRVCDGSPAADFLKTVKALLEEPAGLIL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagtagtaatgccgaagctgggaatggcgatgaagaaaggtgaagtatcc
gtctggaataaaaaagtcggcgacccggttgaaaagggagaaagcatcgccagcatcaac
tcggaaaaaatagaaatggaaatagaagcgcctgaaagcggcacgcttctccatattaaa
gtcaaagagggagaaggagtcccgccgggaacgcccatctgttatatcggggaaaacggc
gaagaagtgctggagaaggaggcgccggctcctgaaaatgcagggaaaccgcaatctgaa
cctgaacatattcccgctcccaaagccgtgcaaaagcgtaaacaccgcgtgaaaatatct
cccgttgcccgaaaaatggcggagaaagccgggttgaaagttgaaacgctgaacgggacg
gggcccggaggcagaatcgtaaaagctgacgtcatcaaggccatgaagacggaagctgaa
ccgcagtcttcggttcagacggcacagccggaggaaaaaccggcttcagcgatgagaaaa
gtcattgcagaccgaatgcacaaaagcctgcaaaacagcgcccagctgacgttgactatg
aaagcggacattacggagcttgtaaaatggcaggagcagctcgccgacagcgcgaaaaag
cggagcggtgttaaactgacggtcacacatttcgtatcccgggccgcggtgcttgcgctg
aaacagcatcctgagctgaacagctcttatcaagaggagcggatcatcacctatccatat
gtccaccttgggatggcggtttctcttgaaaacggtctcgtcgtgccggtgattcgggat
gcggaaaagctttcattccttgagcttgcggatcacatcagcacatcggcacgccgggcg
cgggaaggcaatgcttccggagatgatctgcacggatcgacattttctattacaaatctc
gggggttacggaattgagcatttcaccccgattcttaatccgcctgaagccggtattctc
ggagtgggcgcaagctatgaaacgcctgcgtttaaaggagatgagcttgtcaaaagcacc
atgctgccgctgagccttacctttgatcacagagtatgtgacggctcaccggctgcggac
ttcctgaaaacggtcaaagcgctgcttgaagagccggccggattgattttatag

DBGET integrated database retrieval system