KEGG   Bacillus velezensis FZB42: RBAM_009150
Entry
RBAM_009150       CDS       T00582                                 

Gene name
rpsN
Definition
(GenBank) 30S ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
bay  Bacillus velezensis FZB42
Pathway
bay03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bay00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RBAM_009150 (rpsN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bay03011]
    RBAM_009150 (rpsN)
Ribosome [BR:bay03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    RBAM_009150 (rpsN)
  Bacteria
    RBAM_009150 (rpsN)
  Archaea
    RBAM_009150 (rpsN)
SSDB
Motif
Pfam: Ribosomal_S14
Other DBs
NCBI-ProteinID: ABS73280
UniProt: A7Z2Q4
Position
896191..896460
AA seq 89 aa
MAKKSKVIKELKRQKLVEQYADIRRELKAKGDWEALSKLPRDSAPARLHNRCTVTGRPRG
YMRKFKLSRIAFRELAHKGRIPGVKKASW
NT seq 270 nt   +upstreamnt  +downstreamnt
atggcaaaaaaatcaaaagtgatcaaagagctcaagcggcagaagcttgttgaacaatat
gcggacatccgaagagaattaaaggcaaaaggagactgggaagcgctgagcaaactgccg
cgtgattctgctccggccaggcttcataaccgctgtacggtgacggggcggccccgcgga
tatatgagaaaatttaaattgtccagaatcgcattcagggagctggcgcataaaggccgg
attcccggggtgaaaaaagcgagctggtaa

DBGET integrated database retrieval system