KEGG   Bacillus velezensis FZB42: RBAM_009670Help
Entry
RBAM_009670       CDS       T00582                                 

Gene name
phoA
Definition
(GenBank) PhoA
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00730  Thiamine metabolism
bay00790  Folate biosynthesis
bay01100  Metabolic pathways
bay02020  Two-component system
Module
bay_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    RBAM_009670 (phoA)
   00790 Folate biosynthesis
    RBAM_009670 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RBAM_009670 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bay04147]
    RBAM_009670 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bay00537]
    RBAM_009670 (phoA)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RBAM_009670 (phoA)
Exosome [BR:bay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RBAM_009670 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bay00537]
 Enzymes
  RBAM_009670 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ABS73331
UniProt: A7Z2V5
Position
complement(945785..947164)
Genome map
AA seq 459 aa AA seqDB search
MSLFKQVRSKLLPAAAVSVLTAGLIAGAGLQHSEQAAAKKQPDKNEIRNVIFMVGDGMGA
PYMNAYRSVINKGKPSDGMKLTAFDPNLTGMMMTYPDDPDSNITDSAAAGTAMATGVKTY
NAAIGVDKKGKRVKSVLEEAKQRGKSTGLVATSEIAHATPAAFGAHNKSRKNMDDIASSY
FDDRINGKQKVDVLLGGGKLNFIRKDRNVTKDFKKAGYSYVTSKQELKKDRNKKILGLFA
DGGLDKAIDRSNAVPSLEDMTTAAIDRLNKNKKGFFLMVEGSQIDWAGHDNDIVGAMSEM
KDFEKAYKAAIAFAKKDKHTLVVATADHTTGGLTIGANDDKNWHVEPILAAKKTPAFMAD
QIKAGKSVSSVLARYTDLKWSKAEIKQIETAAKQDADKSIYKAIIKLFNAKTNSGWTTGD
HTGEEVPVYAYGPGRESFTGLLNNTDQAKKIFHILKHGK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtctatttaaacaggttcgatcaaaacttctgccggctgcagccgtatccgtgctg
acagccggtctgattgcgggtgcggggcttcagcactccgaacaggctgcggcaaaaaaa
cagcctgacaaaaacgaaatcagaaacgtcatcttcatggtcggcgacggaatgggcgct
ccctatatgaacgcctaccgttcggtcattaacaaaggaaagccttcggatggtatgaaa
ctgacggcattcgatcccaatctcaccggtatgatgatgacttatcctgacgatcctgat
tccaatattaccgattccgcggcggctggcacggcaatggccacgggcgtgaaaacgtat
aacgcggcgatcggagtcgataaaaaaggaaagcgggtaaaatccgtcctcgaagaagcg
aaacaaagagggaaatccaccggacttgtcgcaacttcggagattgcccacgccacccct
gcggcattcggagcccataacaaatcccgaaagaacatggatgacatcgcaagcagctac
tttgatgaccgcatcaacggaaaacagaaagtcgatgtgctcctcggaggcggcaagtta
aactttatccgtaaagaccgcaatgtaacaaaggatttcaaaaaagcgggatacagctac
gtgacatcaaaacaggagctcaaaaaggatcgtaacaagaagattctcggcctgtttgcc
gatggcggactcgacaaagcaatcgaccgctcaaacgccgtcccttcattagaagacatg
acaacggcagcgatcgacaggctgaacaagaataaaaaagggtttttcttaatggtcgaa
ggcagccaaattgactgggcgggacatgacaatgatatagtcggcgcaatgagtgaaatg
aaggattttgaaaaagcgtataaagcagcgatcgcatttgccaaaaaggacaaacatacg
cttgtcgttgccacggctgaccataccaccggcggattgacgatcggcgcgaatgacgat
aaaaactggcatgttgaaccgattcttgccgcaaaaaaaactccggcatttatggctgac
caaatcaaagcgggcaaatccgtatcttccgtgcttgcgcgctatacagacctgaaatgg
tcaaaggcggaaatcaaacagatcgaaacggccgcaaaacaggatgctgacaagagcatc
tacaaagcaatcattaagctctttaatgcgaaaaccaacagcggctggacaaccggcgat
catacaggcgaagaagttcccgtttacgcatacggtccgggaagagagtcatttacgggg
cttttaaacaacacagaccaggccaaaaagatctttcacatcctgaaacacggaaaataa

DBGET integrated database retrieval system