KEGG   Bacillus velezensis FZB42: RBAM_014690Help
Entry
RBAM_014690       CDS       T00582                                 

Gene name
ylaM
Definition
(GenBank) YlaM
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00220  Arginine biosynthesis
bay00250  Alanine, aspartate and glutamate metabolism
bay00471  D-Glutamine and D-glutamate metabolism
bay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RBAM_014690 (ylaM)
   00220 Arginine biosynthesis
    RBAM_014690 (ylaM)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RBAM_014690 (ylaM)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     RBAM_014690 (ylaM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Phage_DsbA
Motif
Other DBs
NCBI-ProteinID: ABS73832
UniProt: A7Z4A6
Position
1468125..1469054
Genome map
AA seq 309 aa AA seqDB search
MVCRHYQELDALVQEAKKRTEEGKVADYIPALAESEQDSLSVTIYHAENTCLTAGDADRT
FTLQSISKVLSLALVLMDYGKEKVFSCVGQEPTGDPFNSMIKLETVNPGKPLNPMINAGA
LVVTGFIKGHSPKDRLDYLLGFIRRLANNQDITYCRHVAESEFSSSMINRAMCYYMKQYD
IFEGDVEEVMDLYTKQCAIKMSSLDLAKIGCVFALDGKHPETGEQVIKKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYNFGIGIFGPALDEKGNSIAGVKLLEIM
SEKYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccggcattaccaagagctggacgcattagttcaggaagcgaaaaaaagaacc
gaagaaggcaaagtggcagactatattccggctctggctgaatctgaacaagacagcctt
tcggtcacaatttatcatgcggaaaatacatgtctgacggcaggagacgccgaccggaca
tttacgctgcagagcatttcgaaagtgctttctctggcgctcgtactgatggattacgga
aaggaaaaggtgttcagctgcgtgggtcaggagccgaccggcgacccgtttaattccatg
attaagcttgaaacagtgaatccgggcaagcctttaaatccgatgattaatgcgggcgct
ctcgtcgttacgggtttcattaaagggcattcgccgaaagaccgcctggattacctgctc
ggatttatcagaagacttgcgaataatcaggacattacatattgcagacatgtcgcggaa
tcggaattcagttcatccatgattaatcgggccatgtgttattacatgaagcagtatgac
atttttgaaggcgatgtagaagaggtcatggatctgtatacaaaacagtgcgcgattaag
atgagcagtctggacttagccaaaatcggctgcgtattcgcccttgacggcaagcatccg
gaaaccggggagcaggtcattaaaaaagatgtggcgagaatctgcaagacgtttatggtg
acatgcggcatgtacaatgcgagcggggaattcgcgattaaggtcggcattcccgctaaa
agcggcgtttcgggagggatcatgggcatttcgccgtacaacttcggaatcggtatattc
ggcccggcgcttgatgaaaaaggcaacagcatcgcgggtgtgaagcttttggaaatcatg
tctgagaaatacaggctgagtattttttga

DBGET integrated database retrieval system