KEGG   Bacillus velezensis FZB42: RBAM_016390Help
Entry
RBAM_016390       CDS       T00582                                 

Gene name
dxr
Definition
(GenBank) Dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00900  Terpenoid backbone biosynthesis
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01130  Biosynthesis of antibiotics
Module
bay_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBAM_016390 (dxr)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RBAM_016390 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABS74002
UniProt: A7Z4S6
Position
1637922..1639073
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRMHQDQFRLVSMTFGKNAEKAIPLIRTFQPKYIAVGDMD
TYQKVKEASFSHECQIGIGEEGLIEAAVMDEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKGHAKRYGVPLLPVDSEHSAIFQALQGEQCKNIERLVITASGGSFRD
KTRQELESVTIADALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDRSVIAQLGNPDMRVPIQYALTYPDRLPLPETKRLELWEIGSLHFAKAD
FERFRCLQFAFESGKIGGTMPTVLNAANEEAVAAFLAGRISFLSIEDLIEQALDRHSVIQ
DPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatatttgtcttttaggagcaacaggatcaataggggagcagacgttagacgta
ttgcgcatgcatcaagatcagttccgtctcgtctcgatgactttcggtaaaaacgccgag
aaagcgatcccgttgatcagaacgtttcagccgaaatatatagcagtcggcgacatggat
acatatcaaaaagtgaaagaagcgtctttttcgcatgaatgtcaaatcggcatcggagaa
gaaggcctgattgaagcagcagtcatggacgaagtggatatcgtggtcaatgcgctgctt
ggaagcgtcggtttaatcccgactttgaaagcgattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactctcgtcactgccgggcatatagtgaaaggacacgcaaaacgatac
ggtgttcctcttcttccggtcgacagcgaacattccgctattttccaggcgctgcaaggc
gaacagtgcaaaaatatcgagcgcctggtcattacggcatccggcggcagtttcagagat
aaaacgcggcaggagcttgagtctgtaacgattgccgacgcccttaaccacccgaactgg
tcgatgggcgcaaaaattacgattgactcggctacaatgatgaataaaggacttgaagtc
attgaggcgcattggctgtttgacattccgtatgaacagattgacgttgtattacataag
gagagcatcattcattcgatggttgaatttcacgacagaagcgtcatcgcccagctcgga
aatccggacatgagggtgccgattcaatatgcgctgacatatccggaccggctgcctctg
cctgaaacaaaaaggcttgaattatgggagatcggaagcctccattttgcgaaagctgac
tttgaaaggttccgctgcttacaatttgcctttgaatcaggtaaaatagggggaacgatg
ccgacggttttaaatgcggccaacgaagaagccgttgccgcttttcttgccggacggatt
tcattcttatcgattgaggacctgattgaacaagcattggaccgccacagcgtaattcag
gatccgagtcttgcggatatccaagaagtggacaaagacacccggggatacgttaattca
atactcacataa

DBGET integrated database retrieval system