KEGG   Bacillus velezensis FZB42: RBAM_018310Help
Entry
RBAM_018310       CDS       T00582                                 

Gene name
yngB
Definition
(GenBank) YngB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00040  Pentose and glucuronate interconversions
bay00052  Galactose metabolism
bay00500  Starch and sucrose metabolism
bay00520  Amino sugar and nucleotide sugar metabolism
bay01100  Metabolic pathways
bay01130  Biosynthesis of antibiotics
Module
bay_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RBAM_018310 (yngB)
   00052 Galactose metabolism
    RBAM_018310 (yngB)
   00500 Starch and sucrose metabolism
    RBAM_018310 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    RBAM_018310 (yngB)
Enzymes [BR:bay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RBAM_018310 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ABS74194
UniProt: A7Z5B8
Position
1919799..1920692
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAAAGIEDILIITGR
NKRSIEDHFDRSAELEFNLEEKGKTETLKEMQRIADLANIHYLRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSDTPALSQLIDVYNQHGTETVGVQPVDPADVSKYGIIQTGRQG
GHVYQVEDLIEKPAVEKAPSHIAVMGRYILTPAIFKTLKTIGRGAGNEIQLTDALREVCR
TRSIYARELEGSRFDIGDKFGCFKAGTEIGLLREEMRPKLLAYLEEVLKRESEEIVR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggtcattcccgcagcaggtttaggaacgagatttctg
ccggcgacaaaggcgcagcctaaagaaatgctgccgattgtcgacaaaccggccatccaa
tatattgtcgaagaggccgcagcggcaggaattgaagatatattgattattacagggaga
aacaaacgctcgattgaagatcattttgaccggtcggcggaattggaattcaatcttgag
gaaaaaggcaagacggagacgctgaaggagatgcagcggattgccgatttggccaatatt
cattacctccgtcagaaagaaccgctcggactaggacatgcggtgctgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggtgatgatattatggtatctgacact
cccgctctttcacagctcatagacgtctataaccaacacggcacagaaacggtcggcgta
cagcccgtcgatcctgctgatgtcagcaaatatggtattatacagacggggcggcagggc
ggtcatgtgtaccaggttgaggatctgattgagaaaccggctgttgaaaaggcgccctct
catattgccgtgatgggccgctacatattaacccctgctatttttaaaacgctgaagacg
atcggaagaggcgcgggcaacgaaatccaattgacagacgcgctgcgcgaagtgtgccgc
acccgaagcatttacgcgcgggagcttgaaggaagccggtttgatataggagataagttc
ggctgttttaaggccggcacggagatcgggcttctgcgggaagaaatgagaccgaaactt
ttagcttatttagaagaggtgttaaaaagagaatctgaagaaatcgtgcgttaa

DBGET integrated database retrieval system