KEGG   Bacillus velezensis FZB42: RBAM_020050Help
Entry
RBAM_020050       CDS       T00582                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00270  Cysteine and methionine metabolism
bay00920  Sulfur metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01130  Biosynthesis of antibiotics
bay01230  Biosynthesis of amino acids
Module
bay_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RBAM_020050 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RBAM_020050 (metA)
Enzymes [BR:bay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     RBAM_020050 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     RBAM_020050 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase
Motif
Other DBs
NCBI-ProteinID: ABS74367
UniProt: A7Z5U1
Position
2111047..2111952
Genome map
AA seq 301 aa AA seqDB search
MPINIPNHLPAKQVLESEHIFVMDESRAFHQDIRPQKIVILNLMPKKIQTETQLLRMLGN
SPLQVHFTFLIPSTHTPKNTARQHLDEFYTDFSSIRHKRFDGMIITGAPIEHLPFEDVSY
WEELKEIMEWSKTNVTSTLHICWGAQAGLYYHYGIEKVELPKKIFGVFEHTVLKKHERLV
RGFDELYYVPHSRHTDINTEQLQSASDLDVLSVSEEAGVCLIVSKDEKQIFLTGHPEYDT
DTLLQEYERDIERNLSNVEAPKHYFAPGGKEPVNRWKAHATLLFMNWLNYYVYQETPYEW
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgcctattaatataccaaatcacctgcccgctaagcaggtgcttgaaagtgaacacatc
tttgtaatggatgaaagccgggcttttcatcaggatatccggccgcagaagatcgtgatt
ttaaatctgatgccgaaaaaaatccaaacggaaacccagctcctcaggatgcttgggaat
tcacctttacaagttcactttacgttcttaattccgagcacacatactccaaaaaatacg
gcaaggcagcatctggatgagttttatacggatttttccagcatccgccacaaacggttt
gacggaatgattattaccggggctccgattgagcacctgccgtttgaagatgtttcttac
tgggaagaattgaaggaaatcatggaatggagcaaaacgaatgtcacttcaaccctccat
atctgctggggcgctcaagccggtttatactatcattacggcattgagaaagtggagctg
ccgaaaaaaatcttcggtgtgtttgagcataccgttcttaaaaaacatgagagattggta
agaggatttgacgagctatactatgtgccccactcacggcatacagatattaatacggag
cagctgcaatcggcttcggatctggatgtgctcagcgtttcagaggaagcgggggtctgt
ttaatcgtttcaaaagacgaaaaacagattttcttaacgggtcatccggaatatgatacc
gatacgctacttcaggagtatgagagagacatagagagaaatctttcaaacgtagaagct
cctaagcactattttgcgcccggcgggaaagaacctgttaaccgctggaaagctcatgca
acgttattgtttatgaattggctgaattattacgtatatcaggaaaccccgtatgaatgg
gattaa

DBGET integrated database retrieval system