KEGG   Bacillus velezensis FZB42: RBAM_020790Help
Entry
RBAM_020790       CDS       T00582                                 

Gene name
trpA
Definition
(GenBank) TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00260  Glycine, serine and threonine metabolism
bay00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01130  Biosynthesis of antibiotics
bay01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RBAM_020790 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RBAM_020790 (trpA)
Enzymes [BR:bay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RBAM_020790 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA Ste50p-SAM
Motif
Other DBs
NCBI-ProteinID: ABS74441
UniProt: A7Z615
Position
complement(2178010..2178807)
Genome map
AA seq 265 aa AA seqDB search
MFNLRDSEKLFIPFITAGDPLPDISVELAISLQNAGASALEIGVPYTDPLADGPVIQRAS
KRALENGMNIVKAIELGGKMKKNGVHIPIILFTYYNPVLQLEKEYFFALLRENDIDGLLV
PDLPLEESALLQMTCKKENIAYISLVAPTSEDRLKIITEQACGFVYCVSSLGVTGVRSEF
DPSVYSFIRKVKEFSSVPVAVGFGISNRKQVDGMNEISDGVVVGSALVKKIEELKTKLVN
PGTRADALLEFEEYAKTFGRLYSVK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctgcgagattctgaaaaattatttatcccttttattacggctggcgatccg
cttcctgacatttctgttgagctggcaatatcattgcagaatgcaggcgcctctgccctt
gaaatcggcgttccttacacagatccgcttgcggacggacccgtcatacaacgggcttca
aaacgggctctggaaaacggaatgaatatcgtaaaagcaattgaacttggcggcaaaatg
aaaaaaaacggcgttcatattccaattatcctctttacgtattataatcctgtgttacaa
ttagaaaaagaatactttttcgctttactgcgggaaaacgacatagacggtctgcttgta
cccgaccttccattagaggaaagcgcccttttgcaaatgacatgcaaaaaggagaacatc
gcttatatctcactggttgcgccgacaagtgaagaccgtttgaaaataattactgaacag
gcctgcggctttgtgtattgtgtatcctctttaggagtgacgggcgtacgcagcgaattc
gatccgtctgtatactctttcatacgtaaggtgaaagaattcagctctgttccggtggcg
gtcggttttggcatttcaaaccgcaaacaggttgacgggatgaatgaaatatctgacggt
gtcgttgtcggcagcgcgcttgtcaaaaaaattgaagagcttaaaacaaagcttgtgaat
cccggaacaagagctgatgcgcttcttgaatttgaagaatacgcaaagacgttcggacga
ctgtacagtgtaaaatga

DBGET integrated database retrieval system