KEGG   Bacillus velezensis FZB42: RBAM_022450Help
Entry
RBAM_022450       CDS       T00582                                 

Gene name
mmgA
Definition
(GenBank) MmgA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00071  Fatty acid degradation
bay00072  Synthesis and degradation of ketone bodies
bay00280  Valine, leucine and isoleucine degradation
bay00310  Lysine degradation
bay00362  Benzoate degradation
bay00380  Tryptophan metabolism
bay00620  Pyruvate metabolism
bay00630  Glyoxylate and dicarboxylate metabolism
bay00640  Propanoate metabolism
bay00650  Butanoate metabolism
bay00900  Terpenoid backbone biosynthesis
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
bay01200  Carbon metabolism
bay01212  Fatty acid metabolism
bay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBAM_022450 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    RBAM_022450 (mmgA)
   00640 Propanoate metabolism
    RBAM_022450 (mmgA)
   00650 Butanoate metabolism
    RBAM_022450 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RBAM_022450 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    RBAM_022450 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBAM_022450 (mmgA)
   00310 Lysine degradation
    RBAM_022450 (mmgA)
   00380 Tryptophan metabolism
    RBAM_022450 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBAM_022450 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBAM_022450 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RBAM_022450 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bay04147]
    RBAM_022450 (mmgA)
Enzymes [BR:bay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RBAM_022450 (mmgA)
Exosome [BR:bay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RBAM_022450 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: ABS74606
UniProt: A7Z6I0
Position
complement(2383228..2384409)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGVAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaatttggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagattccggcacggcaggctgcaagatatgccgggcttccgtggtccgttccg
gctgaaaccattaataaggtctgtgcatcagggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagtcagaaacgcgcggctgaggcggccgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaagggcaaacagcataccgttgaagcggatgaggggctg
cgccctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggcaggagcatttgtgctgatg
tcagaggaaaaagccgcgaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtccgagctggccagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctggtgagtgaaaaaatagccgggttcagccgggaaaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggagggggtttaggcgtagcggctatatgcagc
ggagcggctcaaggagatgccgtcctgcttgaggtgtactga

DBGET integrated database retrieval system