KEGG   Bacillus velezensis FZB42: RBAM_029500Help
Entry
RBAM_029500       CDS       T00582                                 

Gene name
pucH
Definition
(GenBank) PucH
  KO
K01466  allantoinase [EC:3.5.2.5]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00230  Purine metabolism
bay01100  Metabolic pathways
bay01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bay00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RBAM_029500 (pucH)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.5  allantoinase
     RBAM_029500 (pucH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Usp Urease_alpha
Motif
Other DBs
NCBI-ProteinID: ABS75281
UniProt: A7Z8F5
Position
complement(3071495..3072859)
Genome map
AA seq 454 aa AA seqDB search
MAYDVIVKGAKAVRKGGTERADIAVKDGKIALIGPGIDENAEQVVQADGMYVFPGAVDCH
VHFNEPGREEWEGIETGSNMLAAGGCTSYFDMPLNCIPSTVTAENLLAKAEIAERKSAVD
FALWGGLMPGYTEHIRPMAEAGAIGFKAFLSKSGTDEFQSADERTLLKGMKEIAACGKVL
ALHAESDALTRFLEAEYALQGKIDVRAYASSRPEEAECEAVQRAIEYARATGCALHFVHI
STKRAVLSIQQAKKDGLDVTVETCPHYLLFSFEDFLKKGAAAKCAPPLRSEADKEELIGV
LAEGLIDMVSSDHSPCHPSLKREDNMFLSWGGISGGQFTLLGMIQLAIDHGIPFEHVARW
TAEAPAKRFGLTNKGRLEEGFDADFAIVRPEPFTVTKETMFSKHKQSLYEGHTFPYRIAA
TYSKGRCVYQDGGRKQSGAFGTFLKPSEIKEPIL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgacgtaattgtaaagggtgcgaaagctgtgcgaaaaggcggaacagagcgg
gctgatatcgccgtcaaggacgggaaaatcgccttgatcgggcccggcattgacgaaaac
gcggaacaagtggtgcaggcggacggcatgtatgtgtttccgggagcggtcgattgtcac
gtgcatttcaatgaacccggccgcgaagaatgggaaggcattgaaaccggctcaaacatg
ctggctgccggcggctgtacgtcttattttgatatgccgcttaactgcatcccttcgacg
gtaactgctgaaaacctgctggcaaaggcggaaatcgccgaacggaagtcagcggttgat
tttgcgctttggggcggtttgatgcccggatataccgaacatatccggccgatggcagaa
gcgggggcaatcgggtttaaagcgtttctgtctaaatcgggaacggatgaatttcaatca
gccgatgaacggactcttttaaagggaatgaaggaaatcgcggcgtgcggcaaggttttg
gccctgcacgcagaaagcgacgccctcacccgattccttgaagccgagtacgcgctccaa
gggaaaattgatgtccgcgcttacgcttcctcccgtccggaagaggccgaatgcgaggct
gtgcagcgggcgattgaatatgcaagagcgacgggatgcgcgcttcattttgtacatatc
agcacgaaacgggccgtgctctccattcagcaggcgaaaaaagacggattggatgtcacc
gttgaaacgtgtccgcactacttattattcagctttgaagacttcctcaaaaaaggggcg
gccgccaaatgcgctccgccgctccgctcagaggctgataaagaggaattgatcggggtt
ttggcagagggcctgattgatatggtgtcttcggatcattctccctgtcatccgtctttg
aaacgcgaggataatatgttcctgtcgtggggcgggatcagcggaggccaatttacgctt
ctcggcatgattcaattagcgatcgatcatgggattccgtttgaacatgtggcccgatgg
acggccgaagcacctgccaagcgcttcgggttaacgaataaaggccggcttgaagaagga
tttgacgctgattttgccatcgtccggccggaaccttttaccgtcacaaaagaaacgatg
ttttccaaacataagcaaagcctgtatgaaggccacacctttccataccgaattgctgca
acctacagtaaggggcgctgtgtgtatcaggatggcggccgtaagcagagcggggctttc
ggaacattcctgaagccttctgaaataaaagagccgattctctga

DBGET integrated database retrieval system