KEGG   Bacillus velezensis FZB42: RBAM_032820Help
Entry
RBAM_032820       CDS       T00582                                 

Gene name
gtaB
Definition
(GenBank) GtaB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00040  Pentose and glucuronate interconversions
bay00052  Galactose metabolism
bay00500  Starch and sucrose metabolism
bay00520  Amino sugar and nucleotide sugar metabolism
bay01100  Metabolic pathways
bay01130  Biosynthesis of antibiotics
Module
bay_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RBAM_032820 (gtaB)
   00052 Galactose metabolism
    RBAM_032820 (gtaB)
   00500 Starch and sucrose metabolism
    RBAM_032820 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    RBAM_032820 (gtaB)
Enzymes [BR:bay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RBAM_032820 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ABS75612
UniProt: A7Z9D6
Position
3400753..3401637
Genome map
AA seq 294 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVESGIEDIIIVTGKG
KRAIEDHFDNAPELERNLEEKGKIELLQKVKKSSNIADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSIIGVQQVPESDTHRYGIIDPLTNEG
RRYQVKNFVEKPEPGTAPSNLAILGRYVFTPEIFMYLEQQEVGAGGEIQLTDAIQKLNDI
QRVFAYDFEGKRYDVGEKLGFIETTLEFALQDQDIRHKLIPFMKDLLEKEEADE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagtacgcaaagccattattccggcagcaggtttaggcactcgttttttgccg
gccacaaaagcaatgcctaaagaaatgcttccaatcgttgataagccgacaattcagtat
attatcgaagaagctgtcgaatccggcatcgaagatattattatcgtaaccggaaaagga
aaaagagcaatagaagaccatttcgacaatgcccctgaactggaacgtaatttagaagaa
aaagggaaaatcgaactgcttcaaaaagtgaaaaaatcgtcaaatattgcggatatccac
tatattcgccaaaaagagccaaaaggactcggtcatgccgtttggtgcgcacgcaacttc
atcggcgatgaacctttcgccgttcttctcggcgatgatattgtccaggctgaaaaaccg
ggacttcgtcagctgatggatgaatacgaaaaaacattgtcttcaatcatcggtgttcag
caagttcctgaaagcgacacacaccgctacggaattatcgatccgttaacaaatgaaggc
cgccgttaccaggtcaaaaattttgtagagaagcctgaaccgggcacagctccttccaac
ttggctattttaggaagatacgttttcactcctgaaattttcatgtacctggaacagcag
gaagtcggtgcaggaggagaaattcaattaacggacgccatccaaaagctcaatgacatt
cagcgtgtcttcgcttatgatttcgaaggaaaacgttacgatgtcggtgaaaaactcgga
tttatcgagacgacgcttgaatttgccttacaggatcaggatatccgccataaattaatt
ccgttcatgaaggatcttcttgaaaaagaagaagctgacgaatag

DBGET integrated database retrieval system