KEGG   Bacillus velezensis FZB42: RBAM_037000Help
Entry
RBAM_037000       CDS       T00582                                 

Gene name
fbp
Definition
(GenBank) Fbp
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00010  Glycolysis / Gluconeogenesis
bay00030  Pentose phosphate pathway
bay00051  Fructose and mannose metabolism
bay00680  Methane metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
bay01200  Carbon metabolism
Module
bay_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBAM_037000 (fbp)
   00030 Pentose phosphate pathway
    RBAM_037000 (fbp)
   00051 Fructose and mannose metabolism
    RBAM_037000 (fbp)
  Energy metabolism
   00680 Methane metabolism
    RBAM_037000 (fbp)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     RBAM_037000 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ABS76029
UniProt: A7ZAK3
Position
3809403..3811328
Genome map
AA seq 641 aa AA seqDB search
METKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDTKEALNEWYKETIHRMIKLV
SYCSSKYTRSKLRKALPAQFAYISEELLYKTEQAANKEQYYSEIIEQIIALGQADKLITG
LAYSTQRLVVDHLHVVGDIYDRGPQPDKIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPSFRPKADENRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDRNEITLNGKTYQLENTCFATVNP
KQPDELLEEEAEVMDKLLFSVQNSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
SMETMMIEDKAYAGRELLDVFERFLREAFAHPEETDDLATDMTWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEAACRNILMEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELMKEVAILEKLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacgaaatatttagatctgctcgcacaaaaatacgattgtgaagaaaaagtggtc
acggaaatcattaatctgaaagcgatactgaacctgccgaaaggaaccgagcatttcgtc
agtgatctgcacggggagtatcaggcattccagcacgtgctgcggaacggttcaggaagg
gttaaagagaagatccgcgatattttcagcggcgtcatttacgatagagaaattgatgaa
ctggcggctttggtctattatccggaagacaaactgaagctgatcaaacatgactttgat
acgaaagaggcattaaacgagtggtataaagaaacgattcaccggatgattaagctcgtt
tcttattgttcttccaagtacacccgctccaaattgcgcaaagcactgcccgcccaattt
gcttatatttccgaagagctgctgtacaaaacagaacaagccgccaacaaagaacaatac
tattccgaaatcatagaacagatcattgcgctcggccaggccgataagctgatcaccggc
cttgcctacagcacgcagcgattggtggtcgaccatctgcatgttgtcggcgatatttat
gaccgcggaccgcagccggataagatcatggaagaactgatcaactatcattcagtggat
attcaatgggggaatcatgatgttctctggataggcgcttattccggctcaaaagtatgc
ctggcaaacattatccgcatctgtgcccgctatgacaatctggatattattgaagacgtt
tacggcatcaatctgagaccgctattgaaccttgccgaaaaatattacgatgataacccg
tctttccgcccgaaagcggacgaaaacagaccagaagatgagattaaacaaatcacaaaa
attcatcaggcgatcgcgatgatccaattcaagcttgagagcccgattattaagagacgg
ccgaactttaatatggaggaacggctgttactggaaaagatcgattatgaccgcaatgaa
atcacgctgaacggaaaaacatatcaactggaaaacacctgctttgcgacggtgaatcct
aaacagcctgacgagctgttagaagaagaagcagaagtcatggacaagctgctgttctct
gttcagaactccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgctgattcacggctgtattcccgtcgatgaaaacggc
agcatggaaacgatgatgatagaggataaagcttatgcgggccgagagctgctagatgta
tttgaacggttcttacgggaagcgtttgcccatccggaagaaaccgatgatctggcgaca
gatatgacttggtacttatggacaggcgaatactcctctctctttggaaaacgcgccatg
acaacctttgagcggtatttcattaaagagaaggaaacgcataaagaaaagaaaaacccg
tattactatttgcgtgaagacgaagcagcctgccgaaacatcctgatggaattcggtctc
aacccggatcacggccatatcatcaacggccatacaccggtaaaagaaatcgaaggcgaa
gatccgatcaaggcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacgctcttatacaactcttacggcatgcagctc
gtcgcccataaacactttaactccaaggccgaagtgctgagcaccggaaccgacgtctta
acagtgaaacgattagtcgacaaagagctggagcggaagaaagtgaaagaaacaaacgtc
ggtgaagaactgatgaaagaagtggcgattttggagaagctgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system