KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_08315Help
Entry
BAMTA208_08315    CDS       T01824                                 

Gene name
gutB5
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:baz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAMTA208_08315 (gutB5)
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BAMTA208_08315 (gutB5)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BAMTA208_08315 (gutB5)
    1.1.1.-  
     BAMTA208_08315 (gutB5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_assoc Cas_csx3
Motif
Other DBs
NCBI-ProteinID: AEB23836
Position
complement(1585258..1586280)
Genome map
AA seq 340 aa AA seqDB search
MKAAVWYGERDIRIEERGTKELQPNDVKIKVAWAGICGSDLHAYLHPDSVPMNKKTVLGH
EFSGEIAEVGSHVTKFKKGDRVCIYPMMLKDPSNAETERFITLDAVGAQIDGGFAEYVIL
PQKTIFKIPDHLPLELAAMVEPAAVSFQSIKDSNVREGDTVVVYGAGPIGLFAVLGAKAA
GASNIIVIDLFNSRLDKATEMGATHVFNAKEVNPVEEIRKLFPDGADVAIEAAGVESTFH
QAIQSTKVRGTMMVISFHTQDIQFNVPASLIFSGAKLMGSVGYSNETYNEVIELFANGRL
PAQSIITSKIDIDNIAEQGFDALINDKSQAKILVKLSGAH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtgtggtatggtgaaagagatattcgtattgaggaaagaggaacgaaa
gaattacaaccaaatgatgtaaaaattaaagtggcatgggctggtatttgcggttctgat
ttgcatgcatacttgcatccagattcagtaccaatgaataagaagacggtacttggacat
gaattttctggtgaaattgcagaggttggctctcatgtaacaaaatttaaaaaaggtgac
agagtatgtatctacccaatgatgcttaaagatccttcaaatgctgaaactgaacgtttc
atcactttagacgcagttggtgcacaaatcgacggagggtttgctgaatatgtgatactt
ccacaaaaaacgatttttaaaattccagatcatttaccgctagaattggcagccatggtt
gaaccagcagctgtatctttccaatccattaaggattcaaatgtaagagaaggcgatact
gtcgttgtctatggagcaggtcctattgggctatttgctgttttaggtgcaaaagctgca
ggcgcgtctaatattattgttattgatctatttaatagtcgacttgataaagcaactgaa
atgggtgcgacacacgtttttaatgctaaagaagtaaaccctgttgaagaaattcgaaaa
ttattcccagatggagcagatgttgcaattgaagctgcaggtgtcgagtcaacatttcac
caagctattcaatcaactaaagttcgtggcacaatgatggttatcagcttccacacgcaa
gatatccaatttaatgttcctgcttcactaatctttagtggtgcaaaattaatggggtct
gtaggatacagcaatgaaacttacaatgaggtcattgaattatttgctaatggaagatta
cccgcgcaatcaattattacaagtaaaattgatatagataatatcgctgaacaagggttt
gatgcgttaattaatgataaatctcaagcaaaaattctagttaaattaagtggcgcacat
taa

DBGET integrated database retrieval system