KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_10055Help
Entry
BAMTA208_10055    CDS       T01824                                 

Gene name
dapH
Definition
(GenBank) tetrahydrodipicolinate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00300  Lysine biosynthesis
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01230  Biosynthesis of amino acids
Module
baz_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:baz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BAMTA208_10055 (dapH)
Enzymes [BR:baz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     BAMTA208_10055 (dapH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2 UCH_C
Motif
Other DBs
NCBI-ProteinID: AEB24178
Position
complement(1983523..1984233)
Genome map
AA seq 236 aa AA seqDB search
MKMMDANEIISFIQNSTKSTPVKVYVKGDLEGISFGDSSKTFLNGQSGVVFGEWADIKAA
IEENKDKIEDYVIENDRRNSAIPMLDMKDVKARIEPGAIIRDQVEIGDNAVIMMGASINI
GSVIGEGTMIDMNVVLGGRATVGKNCHIGAGSVLAGVIEPPSAKPVVVEDDVVIGANAVV
LEGVTIGKGAVVAAGAIVVNDVEPYTVVAGTPAKKIKDIDEKTKGKTEIKQELRQL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatggatgcaaatgaaattatttcatttattcaaaatagtacaaaatcaaca
cctgtaaaagtgtatgtaaaaggcgaccttgagggaatcagctttggagattcctctaaa
acattcctaaacggccaatccggcgtcgtttttggcgagtgggctgacattaaagccgca
attgaagaaaacaaagacaaaattgaggattacgtcattgaaaatgaccgccgcaactct
gcaattccgatgcttgacatgaaagatgtaaaagcgcgcatcgagcctggcgctattatc
cgcgaccaagtcgaaatcggcgacaatgccgttatcatgatgggtgcgtctattaatatc
ggttcagtcatcggcgaaggcacaatgattgatatgaacgttgtgctcggaggacgcgcg
actgtcggcaaaaactgccacatcggagcgggttctgtattagcgggtgtcatcgagccg
ccaagcgctaagcctgttgtcgtggaagacgacgttgtaatcggcgcaaatgcggttgtt
cttgaaggcgtaacaatcggtaaaggcgcggttgtcgctgcgggagccatcgttgtaaac
gacgttgagccatataccgttgtagcgggaacaccagcgaaaaaaatcaaagatatcgat
gaaaaaacaaaaggcaaaacagaaatcaaacaggaattacgccagctgtaa

DBGET integrated database retrieval system