KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_12190Help
Entry
BAMTA208_12190    CDS       T01824                                 

Gene name
proI
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00330  Arginine and proline metabolism
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01130  Biosynthesis of antibiotics
baz01230  Biosynthesis of amino acids
Module
baz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:baz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BAMTA208_12190 (proI)
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BAMTA208_12190 (proI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH ApbA GFO_IDH_MocA IlvN Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEB24603
Position
2341356..2342198
Genome map
AA seq 280 aa AA seqDB search
MKKIGFIGAGSMAEAMVNGLLQSGLTAPGHIYMTNRSNDSRLEELQDTYGVKPCRDKEEF
FSNTDIIVLAFKPKDAAESIENIREYVKDQLVISVIAGLTIHTIQHYFGRKLTIIRAMPN
TSAAIQQSATGFSASPEASEAEIRMAKELLETIGEATLFEEKHLDAVTAIAGSGPAYVYR
YVEAMEKAALQVGLPEETAKELILQTMAGATEMLRKSSKRPERLRKEITSPGGTTEAGLR
ALNERRFEEAIIHCITETAARSAEIKEQFAGSVLQKTDQS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcggttttatcggggccggatcaatggcggaagcaatggtgaacggactg
ctgcagagcggactgacagcccccggacatatatacatgacaaaccggtcaaatgacagc
cggcttgaagaacttcaagacacgtacggcgtgaaaccatgccgggataaagaagagttt
ttcagcaataccgacattatcgttctcgcctttaaaccgaaagatgcggcagaaagcatt
gagaacattcgcgaatacgttaaagatcagcttgtgatttctgtcatcgcagggctgacg
attcacaccattcagcattatttcggcagaaagcttaccatcatccgggcgatgccgaat
acatccgcggccattcaacaatcggcgaccggtttttctgcaagccctgaggcgagtgag
gctgaaatccggatggcaaaagaactgctggaaacaatcggagaagcgacgctttttgag
gaaaaacaccttgatgccgtcacagccattgccggaagcggccccgcctatgtgtaccga
tatgtcgaagcgatggaaaaggccgcccttcaagtcggcctgccggaagagacggcaaaa
gagctgattttacaaaccatggctggagcgacggaaatgctcagaaaaagcagcaaacga
cctgagcgcctgcgcaaggaaatcacaagcccgggcggcacaacggaagcaggccttcgc
gctttaaacgagcgccgctttgaagaagccatcatacactgcattacagaaaccgcagcc
cggagcgcagaaattaaagaacaattcgcaggctccgttctgcaaaagacggatcaatca
taa

DBGET integrated database retrieval system