KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_12390Help
Entry
BAMTA208_12390    CDS       T01824                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00071  Fatty acid degradation
baz00072  Synthesis and degradation of ketone bodies
baz00280  Valine, leucine and isoleucine degradation
baz00310  Lysine degradation
baz00362  Benzoate degradation
baz00380  Tryptophan metabolism
baz00620  Pyruvate metabolism
baz00630  Glyoxylate and dicarboxylate metabolism
baz00640  Propanoate metabolism
baz00650  Butanoate metabolism
baz00900  Terpenoid backbone biosynthesis
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01120  Microbial metabolism in diverse environments
baz01130  Biosynthesis of antibiotics
baz01200  Carbon metabolism
baz01212  Fatty acid metabolism
baz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:baz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAMTA208_12390 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BAMTA208_12390 (mmgA)
   00640 Propanoate metabolism
    BAMTA208_12390 (mmgA)
   00650 Butanoate metabolism
    BAMTA208_12390 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAMTA208_12390 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BAMTA208_12390 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAMTA208_12390 (mmgA)
   00310 Lysine degradation
    BAMTA208_12390 (mmgA)
   00380 Tryptophan metabolism
    BAMTA208_12390 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAMTA208_12390 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAMTA208_12390 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAMTA208_12390 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:baz04147]
    BAMTA208_12390 (mmgA)
Enzymes [BR:baz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAMTA208_12390 (mmgA)
Exosome [BR:baz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAMTA208_12390 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: AEB24641
Position
complement(2377895..2379076)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAGISESEAEGAVMGMVVQAG
AGQIPARQAARHAGLPWSVPAETINKVCASGLRAVTICDQIIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSSAAKKYGISRDEQDHYAL
LSQKRAAEAAETGKLHEEIVPVTWTGKKGKQHTVAADEGLRPDTSLDQLAKLKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LKKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggctagaacgccgttcggaaaattcggcggggca
ttaaaagaggtaaaagcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccggcatcagtgaaagtgaagcagaaggtgcggtgatgggaatggtcgtccaggcgggc
gcggggcagattccggcgcggcaggctgcgaggcatgccgggcttccatggtccgttccg
gctgaaaccattaataaggtctgtgcatcggggctcagagccgttaccatctgtgatcaa
atcatccgggcgaaagatgcggacgtgctgattgcaggcggtatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggagacggggtttttcag
gatttaatggttcatgacgggctgacctgtgcgtttgatcaggtgcatatggctgtccac
ggaagctctgcggccaaaaagtacggcatttcccgagatgaacaggatcattacgctctt
ttaagccagaaacgcgcggctgaggcagctgagacggggaaattgcatgaagaaatcgtc
cccgtcacctggaccggcaaaaagggcaaacagcatactgttgcagcagatgaggggctg
cgtccggatacaagccttgaccagctcgcaaagctcaaacctatttttacagccgacgga
acggtcaccgccggaaacgctcccggtgtaaatgacggcgccggagcatttgtgctgatg
tcggaggaaaaagccgcgaagcagcatgtcagaccgctcgctgcgatacttggttttgcg
tctgtcggactggaagcgtccgagcttgcaagcgcgccgggagaagccatcagccggctc
ttgaaaaaaaccggtttgtccgttgacgacatcgatttgtttgaagtgaatgaagcattt
gcgtccgtcgtcctcgtgagcgaaaaaatagccgggttcagccgggagaaagtgaatgtt
aacgggggggcaattgcgttcggccatccgatcggcgcaagcggagccagaatcatcatg
agtttgatatacgaattaaagcggcgcggcggaggtttaggcatagcggcaatatgcagc
ggagcggctcaaggagacgccgtcctgctggaggtgtactga

DBGET integrated database retrieval system