KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_20270Help
Entry
BAMTA208_20270    CDS       T01824                                 

Gene name
argI
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00220  Arginine biosynthesis
baz00330  Arginine and proline metabolism
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01130  Biosynthesis of antibiotics
baz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BAMTA208_20270 (argI)
   00330 Arginine and proline metabolism
    BAMTA208_20270 (argI)
Enzymes [BR:baz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BAMTA208_20270 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEB26200
Position
complement(3859611..3860501)
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKKD
EELKNLNSVLSGNEQLAQKVDSVIESERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTRVMEETIDYLSGCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggatatgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacctgggcgacatccccgtcaatcgtgaaaaactcaaaaaagat
gaagagctgaaaaatctgaactctgtgctctcaggtaacgagcagctcgcccaaaaggtg
gacagcgtcattgagagtgagcggttccctctcgtcctgggcggcgatcacagcatcgcg
atcggaacgctgacaggaacggccaagcactataaacagctcggtgttatctggtacgac
gcgcacggcgacttaaacacgctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcggccacgacacattggtgaatctgggcggctatgccccg
aaaatcaagccggagaacgtcgtcatcatcggcgcgagatcgcttgatgaaggcgagcgt
gaatacattaaggaaacaggcatgaaggtatatacgatgcatgagattgaccgcctcggc
atgacgagggtcatggaagaaaccattgactacctgtcaggctgtgacggcgttcatctc
agccttgatctcgacggccttgatccgagtgacgcgcccggcgtagggacgcctgtcgtc
ggcggcatcagctaccgtgaaagccatttggcaatggaaatgctgtatgatgccgacatt
atcacctcagctgaatttgttgaagtcaatccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggttgagctggtggagtccttgttaggaaaaaaactattataa

DBGET integrated database retrieval system