KEGG   Bdellovibrio bacteriovorus HD100: Bd0404Help
Entry
Bd0404            CDS       T00159                                 

Gene name
atoB
Definition
(GenBank) InterPro: Thiolase, mitochondrial 3-oxoacyl-Coenzyme A thiolase; hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00071  Fatty acid degradation
bba00072  Synthesis and degradation of ketone bodies
bba00280  Valine, leucine and isoleucine degradation
bba00310  Lysine degradation
bba00362  Benzoate degradation
bba00380  Tryptophan metabolism
bba00620  Pyruvate metabolism
bba00630  Glyoxylate and dicarboxylate metabolism
bba00640  Propanoate metabolism
bba00650  Butanoate metabolism
bba00900  Terpenoid backbone biosynthesis
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
bba01120  Microbial metabolism in diverse environments
bba01130  Biosynthesis of antibiotics
bba01200  Carbon metabolism
bba01212  Fatty acid metabolism
bba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bd0404 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Bd0404 (atoB)
   00640 Propanoate metabolism
    Bd0404 (atoB)
   00650 Butanoate metabolism
    Bd0404 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bd0404 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Bd0404 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bd0404 (atoB)
   00310 Lysine degradation
    Bd0404 (atoB)
   00380 Tryptophan metabolism
    Bd0404 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bd0404 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bd0404 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bd0404 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bba04147]
    Bd0404 (atoB)
Enzymes [BR:bba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bd0404 (atoB)
Exosome [BR:bba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bd0404 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAE78391
UniProt: Q6MQQ6
Position
380675..381856
Genome map
AA seq 393 aa AA seqDB search
MEKIVFISGKRTPFGAFGGSLKDVSATDLGVAAAKATLEQAGLSADKIDHVVFGNVVQSG
ADAAYLPRHIGLKTGVPVAVGAFAVNRLCGSGFQSWVNAVQMIQCGEATAVLAGGVEQMS
QIPYVARKVRFDGMRMGNFELEDLMTSALTDAYAKMPMAITAENLAVKYGITREESDKYS
IQSQQRFQAAVEKGFMKQEICLVTVEGRKGTVVIEKDEHPKPDSTLEKLATLKPVFKKDG
IVTAAAASGIVDGAACSLLMSESKAKELGMKPMARIVSYASVGCDPTIMGIGPAGAARLA
LQKAGLTLDQMDLVEVNEAFAAQYLAVEKELKLDPAKTNVNGGAIAVGHPLGASGTRIMN
HLVYELHRRNAKYALGSACIGGGQGIAIIIERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatcgtatttatctctggaaaaagaactcccttcggagccttcggcggttca
ttgaaggatgtatcagcaacggatctgggtgtcgctgccgctaaagcgaccctggagcaa
gccggtctgtctgcagacaagattgatcacgtggtgtttggcaacgtggttcagtccggt
gcggatgcagcctatcttccaagacatattggtttgaaaaccggagtgccggtcgcggtg
ggcgcttttgcggtcaaccgtctgtgtggcagtggtttccagtcctgggtgaatgccgtg
cagatgatccagtgtggggaagccaccgcggttcttgccggtggtgtcgagcaaatgtcc
cagattccttatgtggcccgcaaagtccgctttgatggcatgcgcatggggaacttcgaa
ctggaagatctgatgacctcggcgctgacggacgcttatgccaagatgcctatggcgatc
acggctgaaaatctggcggtgaaatacggtatcacgcgcgaagaatctgacaagtattcc
atccagtcccagcagcgcttccaggccgcggttgaaaaaggtttcatgaaacaggaaatc
tgcctggtcacagttgagggtcgcaagggcaccgtggtgattgaaaaagacgaacatcca
aaaccggattccactctggaaaaactggcgacgctaaagcctgtcttcaaaaaagacggg
attgtaacggcggcggcggcttccggtattgtcgacggggcggcttgttctttgttgatg
agcgaatccaaagccaaggaactgggcatgaaaccaatggcgcgtatcgtgagctacgct
tctgtgggttgtgacccgacgatcatgggtattggtccagcgggcgcagctcgtctggca
ttacagaaagccggactgactctggatcagatggatctggtggaagtgaacgaagctttt
gcggcccagtacctggcggtggaaaaagaattgaaactggatccggcaaaaaccaatgtg
aacggtggtgcgattgctgtcggtcaccccttgggtgcctccggcacccgcattatgaat
cacctggtgtatgagcttcatcgccgcaacgccaagtacgctctgggttctgcttgtatt
ggcggcggtcagggtattgcgatcatcatcgaaagaatctaa

DBGET integrated database retrieval system