KEGG   Bdellovibrio bacteriovorus HD100: Bd0916
Entry
Bd0916            CDS       T00159                                 

Symbol
pacL
Name
(GenBank) Cation transporting ATPase
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
KEGG Orthology (KO) [BR:bba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bd0916 (pacL)
Enzymes [BR:bba01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     Bd0916 (pacL)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HAD Cation_ATPase_N Hydrolase_3 Cation_ATPase
Other DBs
NCBI-ProteinID: CAE78859
UniProt: Q6MPD9
Position
868516..870993
AA seq 825 aa
MKTTSFGNLKGLVYRSGGLIDSELAEQRSRFPANDIVEVTGNPWIEIFADTIKDPMIWFL
VGVGLAFFLTGEVADGITLFVAVLPLLFMDAFLHWRTQASTAALRGDLSSSVKVYRNAVE
VEVDSRDLVPGDLVLLRQGDVVPADGVFESLQGLQVDESVLTGESFPIVKKATPLEPFFR
SCADEVRVPSEILGAAGTRVLTGHGTLRVIFTGASTSYGEIVRSVSRVPHERTPLQQAIG
RLVQILIFLSVALCLILAMVRFNQGYGWLDALLSAATLAVAAIPEEFPVVFTFFLGVGVY
RLAKKRALVRRAVSVENIGRVTHICTDKTGTITAGQLKLAHFEPSKGDVQTLLGTALASS
SSESDPLDAAIKEVAQERGLTSKASLLVFPFTEDRKRETVISQEVGGPFVANIKGSPETI
IGMSRLLSDEKSRWEGQVSQWARTGHKVIAVARKSSLAPFEQEPGAELEFCGLLAFEDPA
RPEVAGAMEYCRRNGIRVLMITGDHPETSAAIAKDAGLTIAEPVVVSAEDEPLKFQEEWL
HRHADFLKNIDVVARCTPMQKLRIVLALKHFGELVAVTGDGVNDVPALKAADIGIAMGER
GSRSAREVSSIILADDNFSTIINAIREGRQLFKNLKMSFEYLLLIHIPLVATAAVLPLAG
YPLVYLPVHIVWLELVIHPTALLAFQAPSTGTRDEVNAPRIFSSFQVLCICLAGVAVAVL
LGWGFVRALSEGASPERARSGVMALLTLWSAGVAVQLTRFKSEVAIIISTVTVLSSMALI
QSSESLTFLRLAPLSLVEWSAGVVVVGLLTGILAWSRRLFQCIPG
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgaaaaccacttcttttggaaatcttaaagggctggtctatcgaagtggcgggttgata
gattctgagctggcagagcagcggtcccgcttccccgcaaatgacatcgttgaagttaca
ggaaatccctggatagagatcttcgcggacacgatcaaggatccaatgatttggtttctg
gtgggagtcgggctggcattctttctgacaggcgaggttgcagacggaatcactttgttc
gtggcagttcttccgcttctgtttatggatgcatttttacactggagaacccaggcctca
acggcagcccttagaggggacctgtcttcgtccgttaaggtttatcgaaatgctgtcgag
gttgaggtggattcccgggatctggtgccgggggatctggttctgctgaggcaaggggat
gtggttccggccgatggagtttttgaaagcttgcaaggtctgcaagtggatgagtcggtg
ctgaccggagagtcatttccaatagtcaaaaaggcgacgcctctggagccgtttttccgg
tcttgcgctgatgaggtgcgggtgccatcagagatccttggagctgcgggcacgagagtt
ctgacggggcatggaaccctcagagtcattttcacgggtgccagcacatcctacggggaa
attgtccgctccgtttcccgtgtgccgcacgagcgcacccctttgcaacaagcgattggg
cggctggttcagattctgatatttctttccgtcgctttatgtctgattctggcgatggtt
cgattcaaccagggatatgggtggctggacgctcttttgagtgccgccactttggcggtg
gcagccatcccggaagaatttccggtcgtgttcacattctttcttggagttggcgtttat
cgattggctaaaaaacgggcgcttgtccggcgcgctgtcagcgtggaaaacatcggaaga
gtcacacacatttgcacggataaaaccggcacgatcaccgcggggcagttgaagctggcg
cattttgaaccgagcaaaggtgatgttcagacattgctgggaacggcattggcatcctcg
agttctgaatcggacccccttgacgctgcaatcaaagaggttgcgcaagaacggggattg
acaagcaaagccagcctcctggtgtttccatttactgaagaccggaaacgcgaaactgtg
atttcgcaggaagttggtggtccctttgtggcaaacatcaagggttcgccagaaacaatt
atcggaatgtctcgccttctgtcagatgaaaaatcaagatgggagggacaagtttcccag
tgggcccgaacgggccataaggtcattgccgttgccagaaagagttctttggcacccttt
gaacaagagccgggtgccgaactggagttctgtggcttactggccttcgaagatcctgcc
cgacccgaagtggccggagcgatggaatactgtcgcaggaatggcattcgggttttaatg
attaccggagatcatccagagacctctgcggcaattgccaaagatgctggcttgacgatt
gctgagcccgttgttgtgagtgcggaggacgagcccctgaagtttcaggaggagtggctc
caccgccacgctgattttttgaagaacattgatgtcgtggcccgctgtacccccatgcag
aagttgaggatcgttttggcgctgaagcacttcggggagctggttgcagtgaccggtgat
ggtgtcaatgatgtgccggcgttgaaagccgctgacatcggcattgccatgggggagcgg
ggctcacgaagcgcgcgggaagtttcttcaataatcctggccgacgacaacttttcaaca
ataatcaatgcgatacgggagggccggcaactttttaaaaatctaaaaatgagtttcgag
tatcttcttttaatccatattccgcttgtcgcaacggccgctgtcttacctctggcgggg
tatccattggtgtatctgccggtccatattgtgtggctggagctggtgatccatcccacc
gcacttttggcttttcaagcgccaagcacgggcacgcgggatgaagtcaacgctcctcga
attttttcttcatttcaggttctttgcatctgtcttgccggggttgccgtggcggttctt
ttgggctggggatttgtcagagcattgagtgaaggggcctctcccgagcgggcccgttcg
ggagtaatggccctgttaactttatggagtgcgggagttgctgtgcaactcacccgtttt
aaatccgaagtagccatcatcatttccacagtgacggtgctgtcttcgatggccctgatt
cagagttcggagtctttgacctttcttcgcttggcaccgctgtccctggtggaatggagt
gccggtgtcgttgtcgtgggactgctgaccggcattctggcgtggtcccgcagattgttt
caatgcattccaggatga

DBGET integrated database retrieval system