KEGG   Bdellovibrio bacteriovorus HD100: Bd1051Help
Entry
Bd1051            CDS       T00159                                 

Gene name
tpiA
Definition
(GenBank) InterPro: Triosephosphate isomerase; hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00010  Glycolysis / Gluconeogenesis
bba00051  Fructose and mannose metabolism
bba00562  Inositol phosphate metabolism
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
bba01120  Microbial metabolism in diverse environments
bba01130  Biosynthesis of antibiotics
bba01200  Carbon metabolism
bba01230  Biosynthesis of amino acids
Module
bba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bd1051 (tpiA)
   00051 Fructose and mannose metabolism
    Bd1051 (tpiA)
   00562 Inositol phosphate metabolism
    Bd1051 (tpiA)
Enzymes [BR:bba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bd1051 (tpiA)
Exosome [BR:bba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bd1051 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bd1051 (tpiA)
  Exosomal proteins of melanoma cells
   Bd1051 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAE78980
UniProt: Q6MP18
Position
996729..997454
Genome map
AA seq 241 aa AA seqDB search
MKKIFAANWKLFKSPKETREFFGQFKELAGKATGEVVFFPSAISLEAASESLKGTSIKFG
AQNCYFQAQGAFTGENSAQVVKDLGGSYVLIGHSERRAIFGEGDALVADKVAFVQGLGLT
PMLCIGETLQERESAKTFRVLETQLNLGLAKADKTKPVVVAYEPVWAIGTGKVATPEQVA
ETHTDVFNILKALGFETAPILYGGSVKPDNAAGLIKQPHVNGFLVGGASLEAKSFSEIAS
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttttgctgctaactggaagctttttaaatctccaaaagaaacgcgtgag
ttttttggtcagttcaaagaactggcggggaaagcaacgggggaagtggtctttttccct
tcagcgatttctttggaagcagccagtgaatctttgaaaggtacaagcatcaagtttggc
gctcagaactgttacttccaggcacaaggggctttcacgggtgaaaactcggctcaggtg
gttaaagatctggggggcagctatgtattgatcggtcacagcgaacgccgtgcgatcttt
ggtgaaggtgatgcgcttgtggcagacaaagtggctttcgttcaaggtctgggcctgacg
ccgatgttgtgcatcggtgaaaccctgcaagaacgcgaatccgcgaagaccttccgtgtt
ctggaaactcagctaaatctgggtttggcgaaggccgacaaaaccaagccagtggttgtt
gcctatgagccggtttgggcgatcgggacggggaaagtggcgacaccagagcaggtggca
gaaactcacacagacgttttcaatattctaaaagcactgggttttgaaacggcaccgatt
ctttatggtggcagcgtaaaaccggacaatgccgctggtttgatcaaacaaccgcatgtg
aatggtttcctggttgggggagcttctttggaagcaaagtccttcagcgagattgcttcc
gtttag

DBGET integrated database retrieval system