KEGG   Bdellovibrio bacteriovorus HD100: Bd2002
Entry
Bd2002            CDS       T00159                                 

Symbol
yneE
Name
(GenBank) hypothetical transmembrane ptotein yneE
  KO
K08994  ion channel-forming bestrophin family protein
Organism
bba  Bdellovibrio bacteriovorus HD100
Brite
KEGG Orthology (KO) [BR:bba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bba02000]
    Bd2002 (yneE)
Transporters [BR:bba02000]
 Other transporters
  Pores ion channels [TC:1]
   Bd2002 (yneE)
SSDB
Motif
Pfam: Bestrophin DUF1688
Other DBs
NCBI-ProteinID: CAE79851
UniProt: Q6MLK6
Position
complement(1916272..1917204)
AA seq 310 aa
MIEVFTMVIRPKYNWFKMLLVWKGSVLPEILPRLVFIFLLSALVLYFHGVFFSVKVSLNP
TPFTLMGIALAIFLGFRNSAAYDRFWEGRKLWGSLLNVSRSLSRQALTLTGLTANDSESR
RFLQLLIAFAYCTKHQLRKTDATTDLKRLTPDLASELSQVEYKPAVLLRHLGQWVSDQKN
AGRIDSITAGMFDKNLNDMSEILGGCERISNTPIPYPYAVLLHRTVYIYCVLLPFGLMDS
IGWMTPAICTFVAYTFMALDAIVNQIEEPFGTEDNDLALNQMCETIESSVQEMRGEKALP
RNHEGQYVFN
NT seq 933 nt   +upstreamnt  +downstreamnt
ttgatcgaggtgttcacaatggtcattcggcccaaatacaactggttcaaaatgctgctg
gtgtggaagggctcggttctgcccgagatcctgccgcgccttgtttttatctttctgctt
tccgctctggttctttacttccacggcgtgtttttttcagtgaaggtttccctgaatccc
acacctttcacgctgatgggtattgcactggcgatctttctgggttttcgcaactcggcc
gcctatgatcgcttctgggaagggcgaaaactttggggttcgctgctgaatgtttcacgc
tcactttcccgccaggcactgacactcaccggacttaccgccaacgacagcgaaagccgc
agattcctgcagctgctcatcgcctttgcctattgcaccaaacaccagttgcgaaagacc
gatgcaacgacggacttgaaacgcctgaccccggacttggcctctgaactttcccaggtc
gagtataaaccggccgtgctgctgcgccatctgggccagtgggtgtcagatcagaagaat
gccgggcgcatcgacagcatcacggctgggatgtttgacaagaatctgaacgacatgtcc
gagattctggggggctgcgaacgcatctccaacaccccgattccttatccttatgcggtc
cttctgcatcgaactgtatacatttactgtgtgcttttacctttcggcctgatggacagt
attggctggatgacaccggcaatctgcacttttgtggcttatacgtttatggctttggat
gccattgtaaaccagatcgaagagccctttgggaccgaagacaatgacctggcattgaat
caaatgtgcgagaccatcgagtccagcgtgcaggaaatgcgcggtgaaaaagccctgcca
cgcaatcacgagggccagtacgtgttcaactaa

DBGET integrated database retrieval system