KEGG   Bdellovibrio bacteriovorus HD100: Bd2317Help
Entry
Bd2317            CDS       T00159                                 

Gene name
cysS
Definition
(GenBank) hypothetical protein
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bd2317 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bba01007]
    Bd2317 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bba03016]
    Bd2317 (cysS)
Enzymes [BR:bba01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Bd2317 (cysS)
Amino acid related enzymes [BR:bba01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Bd2317 (cysS)
Transfer RNA biogenesis [BR:bba03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Bd2317 (cysS)
 Prokaryotic type
    Bd2317 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: CAE80140
UniProt: Q6MKR7
Position
complement(2213438..2214886)
Genome map
AA seq 482 aa AA seqDB search
MLKIHNSQSKQLEDFTPLTPGQVKMYVCGPTVYNFLHVGNFRGPVVFNMVRNWLEHLGYK
VTYALNFTDVDDKIINRANELGMSPTELSEKYIAEYKKDFASLGLRPHDMNPKVTEHMDD
IRSMVESLVSQKKAYEAQGDVLYSIESFKDYGKLSGRNTDDLLAGARVEVDEKKRNPMDF
ALWKAAKPGEVSWPSPWGPGRPGWHIECSAMIKNLFGDQIDIHGGGMDLIFPHHENEIAQ
SEGCTGKAFVKYWMHNNMLNFGGQKMSKSLGNIVTMREFLEMYNAEIYKWMILSAHYRTL
SDFGDEAVERAVGGLSRVYSALSMAESYLTPEVTQEDAAFAKITQDAWKKVEEAMNHDFG
TPDAFAAMFEVVRQFNAQVRRGMKANPAIQGKALAFHNFVRKMGSMMSLFQEPAHAFLIK
LDDMLLKKMNLERSAVDALVAERGEARAAKDFAKSDELRAKITALGISVSDTPEGSFWEV
TK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagattcacaattcccaaagcaagcagcttgaagatttcacaccactgacgccg
ggacaggtgaaaatgtatgtgtgtggtccgacggtgtataacttcctgcacgtggggaac
ttccgcgggccggtagtctttaacatggttcgcaactggctggaacatctgggttacaaa
gtgacctacgccctgaacttcacggacgttgatgacaagatcatcaaccgtgcgaacgag
ctgggtatgagtccgacggaattgtctgaaaaatacatcgctgaatacaaaaaggatttt
gcgagcctgggccttcgcccgcacgacatgaatccgaaagtgactgagcacatggacgac
atccgctccatggtggaaagtctggtcagtcagaaaaaagcctacgaagcgcaaggcgat
gttctttactccatcgaatccttcaaggactacggcaaactgagtggtcgtaacaccgac
gacttgctggcgggagcgcgagtggaagtcgacgaaaaaaagcgcaacccaatggacttt
gctctgtggaaagcggcaaaaccgggtgaagtgtcctggccatctccttggggcccgggt
cgtccgggctggcacattgagtgctcggcgatgatcaaaaatcttttcggcgatcaaatc
gatattcacgggggcggcatggacttgatcttcccgcaccacgaaaatgaaatcgcgcaa
agtgaaggctgcaccggcaaagccttcgtaaaatactggatgcacaataacatgctgaac
ttcggcggacagaaaatgtccaagtccttggggaacatcgtgaccatgcgagaattcctg
gagatgtataacgccgagatctacaaatggatgatcctgtctgcgcactatcgcaccttg
agtgactttggtgatgaagccgttgagcgcgccgtcggcgggttgtcccgtgtgtactct
gcgctttccatggctgaaagctatctgactccggaagtgactcaggaagatgctgctttt
gcgaaaatcacgcaagacgcctggaagaaagtggaagaagccatgaatcatgacttcgga
actccggacgcgtttgcggcgatgtttgaagtggttcgtcagttcaatgcccaggttcgc
cgtggcatgaaagcgaatcctgcgattcaaggcaaagcgctggccttccataacttcgtt
cgtaaaatgggatcgatgatgagcttgttccaggagccggctcacgcgttcctgatcaag
cttgatgatatgttgctgaagaaaatgaacctggaaagatctgcagtggatgctttggtt
gcagaacggggtgaggctcgcgcagcgaaggactttgcgaagtctgatgaattgcgcgcg
aaaatcacggcattgggtatttctgtcagcgacactccggaaggcagcttctgggaagtg
acgaagtaa

DBGET integrated database retrieval system