KEGG   Bdellovibrio bacteriovorus HD100: Bd3008Help
Entry
Bd3008            CDS       T00159                                 

Gene name
purE
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase catalytic subunit
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00230  Purine metabolism
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
bba01130  Biosynthesis of antibiotics
Module
bba_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bba00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Bd3008 (purE)
Enzymes [BR:bba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     Bd3008 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: CAE80777
UniProt: Q6MIY6
Position
complement(2906390..2907103)
Genome map
AA seq 237 aa AA seqDB search
MKIQVLFGSANDERVYGPLCRSLEKCGDVKMEVASAHRDPARVHEIVKTCGADAFVAGAG
LAAHLPGVVASLTDKPVFGVAVNGAFAGLDAFLSIVQMPRGIPVAAVTEENANTIGDFIV
RLAKVPKDRLCLHWNRCLESYSPIQKALDEIQTQTGLQIEWTAAQAENCLGEIVSPWELP
HTQGLNLFLCEKEQLASSNLALDFYAKARHGGFWVGANNVANFVNQWNKLKVLGASR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaggttctttttggcagtgcgaatgatgaacgtgtgtacggtccgttgtgc
cgttcccttgaaaaatgcggtgacgtgaaaatggaagtggcttccgcccaccgtgatccc
gcccgagtccacgagattgtaaaaacctgcggtgcggatgcttttgtcgccggcgcaggc
ttggctgcccatcttccaggtgtcgtggcgtctttaacagacaagccggtcttcggcgtg
gcggtgaatggggcctttgctggccttgatgccttcttgtcgattgttcagatgccgcgc
ggaattcccgtggcagccgtgacagaagaaaatgccaacaccatcggagacttcatcgtt
cgcctggcgaaagttccaaaagaccgcctgtgtctgcactggaatcgctgcctggaaagt
tattcacctattcaaaaagccctggatgaaattcagactcaaaccggtttgcagatcgaa
tggacggcggctcaggccgaaaactgtctgggcgaaatcgtcagtccttgggagcttccg
cacacgcaagggttgaatctgttcctgtgtgaaaaagaacagctggccagctccaacctg
gcgttggacttttatgccaaggcccgccacggcggattctgggtgggggccaacaacgtg
gccaattttgtgaatcaatggaacaaactgaaagttttaggagcaagccgatga

DBGET integrated database retrieval system