KEGG   Bdellovibrio bacteriovorus HD100: Bd3038Help
Entry
Bd3038            CDS       T00159                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00740  Riboflavin metabolism
bba00790  Folate biosynthesis
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Bd3038 (ribA)
   00790 Folate biosynthesis
    Bd3038 (ribA)
Enzymes [BR:bba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Bd3038 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Bd3038 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 NAPRTase_C
Motif
Other DBs
NCBI-ProteinID: CAE80805
UniProt: Q6MIV8
Position
complement(2950629..2951759)
Genome map
AA seq 376 aa AA seqDB search
MEFNTIPEIIDDVRNGKMVILVDDEDRENEGDLILAAEFATPQNINFMVKEARGLVCLCL
TAQQVERLQLPLMVRDDLNFAPNKTAFMVSIEASEGISTGISAADRALTCRVAANPHAKP
SDIHMPGHIFPIRAQQGGVLKRAGHTEASVDLARLAGLNPAAVICEVMNDDGTMARVGDL
REFAKKHDIKIGTIVDLIAYRLANETLVEELHSVPLPASFGENMQARVFRSTVDGLEHLV
IQKGEIKKDHPTLVRVHVDNFTRDFMAVVQRGASSVLESIKAISQEESGAFVLLRGNNRT
SGLTQELNVLVGLEDIRPTTPLMDERDYGIGAQILREIGANKIRLLTNKPEKKVGLKAFD
IEIVEIVAMENLKGPK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaattcaatacaatccctgagatcatcgatgatgttcgtaacggcaagatggtcatc
ctggtggatgacgaggatcgtgaaaacgaaggcgatctgattctggccgctgaattcgcg
acgccacaaaatatcaacttcatggtgaaagaagcccgcggcctggtgtgcctgtgtctg
acagcccagcaggtcgagcgtctgcagcttccactgatggttcgtgatgatctgaacttt
gcgccgaacaaaacggcgttcatggtcagcatcgaagcttctgaagggatctcgaccggt
atttctgctgccgaccgtgcgctgacgtgccgagtggctgcgaaccctcatgcaaaaccc
tctgacattcacatgccgggtcacatcttcccaatccgcgcccagcagggtggggttttg
aagcgtgcgggtcacacagaggccagcgtggatctggcccgtctggcgggtttgaatccg
gcagccgtgatctgtgaagtgatgaacgatgacggcacaatggctcgcgtgggtgatctg
cgtgagttcgcaaaaaagcacgacatcaaaattggcacgatcgtggatctgatcgcttat
cgtctggcgaatgaaactttggtggaagagctgcacagcgttccactgccggcgtctttt
ggtgaaaacatgcaggcgcgtgttttccgcagcaccgtggatgggttggaacatttggtg
attcaaaaaggtgaaatcaagaaagatcatccgaccctggttcgtgttcacgtggataac
ttcacccgtgatttcatggcggtggttcagcgtggggcttcgtccgtgcttgaaagcatc
aaggcgatttcccaggaagaaagcggtgctttcgtgcttctgcgcgggaacaaccgaact
tccggtctgactcaggagctgaatgttctggtgggtcttgaggacatccgtccgacgacg
ccgttgatggatgaacgtgattacggcattggtgcgcagatcctgcgtgagattggcgcg
aacaaaatccgcctgttgaccaataagcctgaaaagaaagtcggcctgaaggcctttgat
attgaaatcgttgaaattgtcgcaatggaaaacttgaagggaccaaaataa

DBGET integrated database retrieval system