KEGG   Bdellovibrio bacteriovorus HD100: Bd3455Help
Entry
Bd3455            CDS       T00159                                 

Gene name
hemG
Definition
(GenBank) InterPro: Protoporphyrinogen oxidase; hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba00860  Porphyrin and chlorophyll metabolism
bba01100  Metabolic pathways
bba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bd3455 (hemG)
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bd3455 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Bd3455 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 HI0933_like Pyr_redox DAO GIDA FAD_binding_2 NAD_binding_9 Thi4 3HCDH_N UDPG_MGDP_dh_N FAD_oxidored Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CAE78248
UniProt: Q6MHT4
Position
3365110..3366327
Genome map
AA seq 405 aa AA seqDB search
MKTVHVIGAGFAGLTVSLRLAQKGFQVELYESSDRVGGLLGTDQTPYGIAERAANALIRT
EKAEGLFSELGLTPSFPLESSKKRFLFRNSPKAWPLTFLETLTLIGRVLPRVLIGGKKVL
RPQAGETLLNWGERRIGKAPTRFLLGPAMQGIYGNEITHLSASLILGPLFSGAKRSKYKG
LLTGPGGMQDLVDHLQTRLQELGVKIHLNSNVNLASLEGPVVLATSAKAASVLLAEKHPE
FSKVLSKIQMSSLMSVTLFFTKAQEEFKGFGCLIPRGFDLKALGVLMNSYIFKDRDKTYN
ETWILGGQQEEALLDLPDNEILKLLADERFRILGQKDTLLDYRINRWKKALPFYDLNLEN
ALADLAEVPEPAGFYLHGNYLSGIGLSKILERSDWIAEKIASEHG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtgcatgtaatcggcgcgggctttgcgggactgacagtgtccctgaggctc
gcccaaaaaggctttcaggtagaactttatgaatcctcggaccgtgtcgggggattgctg
ggtactgaccagacaccttatggcatcgccgaacgtgccgccaacgccctgattcgcacc
gaaaaagccgaaggccttttcagcgaactggggctgactcccagttttcccctggagtcc
tctaaaaaacgtttccttttccgcaattcaccgaaggcatggccgctgaccttcctggag
acactgaccctgatcggccgtgtgcttccccgtgttttgatcggcggaaaaaaagtcctg
cgccctcaggccggagaaacccttctgaactggggcgagcgcagaatcggcaaagctccg
acaagatttctgctgggccctgcgatgcagggaatttacggcaatgagatcacccatctt
agcgccagtttgattctgggtccgctcttttccggtgccaagcgcagcaaatacaaaggt
cttctgaccggccccggcggaatgcaggacctggtggaccatctgcaaacccgactgcag
gaattgggtgtaaagattcacctgaattccaatgtgaacctggcctctcttgaagggccg
gtggttcttgcgacctctgcaaaggccgcaagcgtgctgctggcggaaaaacatcctgaa
ttttccaaagttctttccaaaattcagatgtcttcactgatgagtgtgaccttgttcttc
accaaggctcaggaagaattcaaaggttttggctgcctgataccacgcggatttgatctg
aaggccctgggggttctgatgaattcctatatcttcaaggaccgcgacaaaacctacaat
gaaacatggattctgggcggtcagcaggaagaggcgttactggatcttcctgacaacgaa
attctgaaactgctggccgacgaacgcttccgcattctgggccagaaagacaccctgctg
gattaccgtatcaaccgctggaaaaaggctttgccattttatgatcttaatctggaaaac
gccctggcggacctggcggaagtgcccgagccagcaggcttctatctgcatggaaattat
ctaagcggtattggattaagcaaaattctggaacgcagcgattggatcgccgaaaagatt
gcgagtgaacatgggtaa

DBGET integrated database retrieval system