KEGG   Bdellovibrio bacteriovorus 109J: EP01_02865Help
Entry
EP01_02865        CDS       T03079                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Pathway
bbac00540  Lipopolysaccharide biosynthesis
bbac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbac00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EP01_02865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bbac01005]
    EP01_02865
Enzymes [BR:bbac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     EP01_02865
Lipopolysaccharide biosynthesis proteins [BR:bbac01005]
 Unusual sugar
  EP01_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AHZ83890
Position
604592..605560
Genome map
AA seq 322 aa AA seqDB search
MIIVTGANGFIGSVMVWELNQKGLTDIIAVDSVGLSERNLLRKQKITKFLLKDDLWPFLE
TEEAKKQVTWIIHMGACSSTTETNKEFLWENNTYYTQRIFEWCAEHGKSMIYASSAATYG
AGELGFDDTTDPEKLRPLNLYGESKVLFDRWAVKQTKTPPHWYGLKFFNVFGPNEYHKGA
MSSVAFKAYNQIKDTGALGLFKSADPNYKDGEFMRDFVYVKDVTGWMAELMDKKPKNGVY
NMGFGKPRTWLDLAGGVFKAMGKDMKINWLEMPENIRGQYQYFTEAKTDKWLAAGMSPAK
WPLEKAVADYIQNYLSKDDKDL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtaacaggcgcaaacggttttattggcagtgtgatggtgtgggaactgaat
caaaaaggtcttaccgatatcatcgcggtggactcggtaggtctttccgaacgcaatctt
cttcgcaaacaaaaaatcaccaagttccttttgaaggatgatctgtggccgttccttgaa
accgaggaagccaagaaacaagtcacttggatcatccacatgggcgcctgctcttccacg
acagaaaccaacaaagagttcctgtgggagaacaacacttactacacgcaaagaatcttt
gaatggtgcgcagaacatggcaagtccatgatctatgcttccagtgctgcaacttacgga
gctggcgaactgggctttgacgacaccaccgatcctgaaaaactgcgtccgctaaatctg
tacggtgaatccaaagtcctgtttgaccgctgggcggtgaaacagacaaaaacgcctccg
cactggtacggccttaagttcttcaacgtctttggcccgaatgaataccacaagggcgcg
atgtccagcgtggcgtttaaagcgtacaatcagatcaaagacaccggcgctttgggattg
ttcaagtccgccgacccgaactacaaagacggcgaattcatgcgtgacttcgtttatgtc
aaagacgtcacgggctggatggccgagctgatggacaaaaaaccaaagaatggcgtttac
aacatgggcttcggaaaaccacgcacatggctggatctggccggtggtgtgttcaaggcc
atgggaaaagacatgaaaatcaactggctggaaatgcctgaaaacatccgcggtcagtat
cagtacttcaccgaagctaaaaccgacaagtggctggccgcgggcatgagcccggcaaaa
tggcctttggaaaaagccgtcgctgattatattcagaactatttgtccaaagacgacaaa
gacctgtaa

DBGET integrated database retrieval system