KEGG   Bdellovibrio bacteriovorus 109J: EP01_03820Help
Entry
EP01_03820        CDS       T03079                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Brite
KEGG Orthology (KO) [BR:bbac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbac03016]
    EP01_03820
Enzymes [BR:bbac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     EP01_03820
Transfer RNA biogenesis [BR:bbac03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    EP01_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AHZ84071
Position
complement(803361..804083)
Genome map
AA seq 240 aa AA seqDB search
MELLYKDEYFIAVNKPSGFHVHPHENVQHRVSRDKICLYHARRMMKQHVYPVHRLDAGTS
GVLLFALSSESASKLCRLFTERATHKTYQAVVRGFVKEEGEVQLPLELDSTGDLVDAHTS
FKRLATVEFPVAVGKKFPTARYSWVEVTPHTGRYHQIRRHFNRISHPLLGDAVHGDSHHN
RFFRNHLEIEGLCLKALRLEFTHPWSGEKVSIEAPPCDKWKKIQLLFDPALPLEGKLKSL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggagttattgtataaagatgaatattttattgccgtgaacaagccttctggctttcat
gtgcatcctcacgagaatgtccagcaccgggtctcccgcgataagatctgcctttaccat
gcccgtcgcatgatgaagcagcacgtgtatccggtgcaccgcctggatgccggcaccagt
ggggtgctgctgtttgccctttcttctgagtctgccagtaaactgtgccgcctgttcacc
gagcgcgccacccataaaacctatcaggcggtggtgcgtggtttcgtaaaggaagaaggc
gaagtgcagctgcccttggagctggattccaccggcgatctggttgacgcccataccagc
tttaaacgcctggcgaccgtggaattccccgtggccgtcggtaaaaaattccccaccgcc
cgctattcctgggtggaggtcaccccgcacaccggtcgctaccaccagatccgccggcac
ttcaaccgcatctcccaccccttgctgggggatgccgtccatggtgattcccaccacaac
cgtttcttcagaaatcacttggaaatcgagggtttgtgcctgaaagccctgcgcttggag
ttcacgcacccctggagtggcgaaaaagtctctatcgaggccccgccttgcgataaatgg
aagaaaattcaacttctgtttgatccggcacttccgcttgagggcaaactgaaatccctt
tga

DBGET integrated database retrieval system