KEGG   Bdellovibrio bacteriovorus 109J: EP01_06490Help
Entry
EP01_06490        CDS       T03079                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbac  Bdellovibrio bacteriovorus 109J
Pathway
bbac00071  Fatty acid degradation
bbac00072  Synthesis and degradation of ketone bodies
bbac00280  Valine, leucine and isoleucine degradation
bbac00310  Lysine degradation
bbac00362  Benzoate degradation
bbac00380  Tryptophan metabolism
bbac00620  Pyruvate metabolism
bbac00630  Glyoxylate and dicarboxylate metabolism
bbac00640  Propanoate metabolism
bbac00650  Butanoate metabolism
bbac00900  Terpenoid backbone biosynthesis
bbac01100  Metabolic pathways
bbac01110  Biosynthesis of secondary metabolites
bbac01120  Microbial metabolism in diverse environments
bbac01130  Biosynthesis of antibiotics
bbac01200  Carbon metabolism
bbac01212  Fatty acid metabolism
bbac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EP01_06490
   00630 Glyoxylate and dicarboxylate metabolism
    EP01_06490
   00640 Propanoate metabolism
    EP01_06490
   00650 Butanoate metabolism
    EP01_06490
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP01_06490
   00072 Synthesis and degradation of ketone bodies
    EP01_06490
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP01_06490
   00310 Lysine degradation
    EP01_06490
   00380 Tryptophan metabolism
    EP01_06490
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EP01_06490
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EP01_06490
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EP01_06490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbac04147]
    EP01_06490
Enzymes [BR:bbac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EP01_06490
Exosome [BR:bbac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EP01_06490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHZ84584
Position
1363559..1364734
Genome map
AA seq 391 aa AA seqDB search
MENVVIVSSVRTPVASFQGGFASVPAPKLGAAAIKEAITRAGVSADEIDECIMGEVLTAG
VGQAPARQAALGAGLKNSTPCMTINKVCGSGLKSVMLAADSIALGHTKIAVAGGQENMTL
APHLLENSRSGYRMGPTQMTDSMIKDGLWDPYNNFHMGNAAEICVKEHNFTREEQDAFAI
DSYKKAQDAWAKNVFKNEIAPVVVEGRKGAVTVDKDEEPFNTNFDKIPGLKPAFDKAGTI
TAANASKINDGAAAHVLMSESEAKKRGIKPLAKIVAHATFAHEPKYFTTAPVGAIKAALN
KANLKVGDVDLWEINEAFAVVTQVAMKELEIPASKVNIHGGAVAIGHPIGASGARILATL
VHALHTHNKRYGLATLCIGGGEAVALIIEKA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgtcgtaattgtgagcagcgtaagaacccctgtagcttctttccaaggaggc
tttgcctctgttcctgcaccaaaactgggtgcagcagccatcaaagaagccatcactcgc
gcaggtgtttctgctgacgaaatcgatgagtgcatcatgggcgaagtcctgactgcaggt
gtcggccaggctccagcgcgtcaagcggcgttgggtgcgggtttgaaaaactccactccg
tgcatgaccatcaacaaagtgtgcggctccggccttaaatccgtgatgctggcagcagac
tctatcgctttgggacacactaaaattgcagtggcaggcggtcaggaaaacatgactttg
gctccacacttgcttgaaaactcccgctccggttaccgcatgggtccaacgcaaatgacc
gactccatgatcaaagacggcctttgggatccatacaacaacttccacatgggtaatgcc
gcggaaatctgcgtgaaagagcacaacttcactcgtgaagaacaagacgctttcgcgatt
gattcctacaaaaaagctcaggacgcgtgggcgaaaaacgttttcaaaaacgaaatcgcc
ccggttgtggttgaaggccgcaaaggtgctgtgaccgtggataaagacgaagagccgttc
aacacgaacttcgacaaaatcccgggtctgaaacctgcattcgacaaagccggcaccatc
acggcggccaatgcttccaaaatcaacgacggtgctgcagcgcacgttttgatgtctgag
tctgaagcgaaaaaacgcggcatcaaacctctggcgaaaatcgtggcacacgctacattc
gctcacgagccaaaatacttcacaactgctccagtgggcgcgatcaaagccgctctgaac
aaagccaacctgaaagtgggcgatgtggatctttgggaaatcaacgaagccttcgccgtt
gtgactcaagtggcgatgaaagaacttgaaatcccggcttccaaagtaaacatccacggt
ggtgctgtggctatcggtcacccgatcggcgcttctggcgcgcgtatcctggcgaccttg
gttcacgctttgcacactcacaacaaacgctacggccttgccactttgtgcatcggtggc
ggcgaagcggtggcactgatcatcgagaaagcgtaa

DBGET integrated database retrieval system