KEGG   Burkholderiales bacterium GJ-E10: E1O_01040Help
Entry
E1O_01040         CDS       T03654                                 

Definition
(GenBank) PutA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00250  Alanine, aspartate and glutamate metabolism
bbag00330  Arginine and proline metabolism
bbag01100  Metabolic pathways
bbag01110  Biosynthesis of secondary metabolites
bbag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E1O_01040
   00330 Arginine and proline metabolism
    E1O_01040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbag03000]
    E1O_01040
Enzymes [BR:bbag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     E1O_01040
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     E1O_01040
Transcription factors [BR:bbag03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    E1O_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: BAP87235
UniProt: A0A0A1H1W1
Position
complement(106649..110434)
Genome map
AA seq 1261 aa AA seqDB search
MAILPFPESSLPALRARIRAAALRPEAECVAELLQRNPLSATQIAAARGPAQALIRALRA
QRSHAHGVDAMMREFSLSSQEGVALLCLAESLLRIPDAATADALIRDKLARGDWRAHIGP
SRSVFLNAAAWGLLLTGKLSATHSETGLTAAVTRAIARGGEPLVRAAIDTAMRMLGEQFV
LGKTIDQALARARSARGRGYRHSYDMLGEAALTAAEAKRYFDAYAGAIAAIAAAEPVADA
AAAPMHPEDRLRRRASVSVKLSALHPRFESLQEDRVRRELLPRIRELCRLARKHGLALDL
DAEEGERLEPLLDIVEALAFDPALADWSGLGIAVQAYQKRALPVIDWLAALARESGRRIG
VRLVKGAYWDREIKRTQVEGLADYPVYTRKAHTDAAYLVCARRLLDHGDHLFPQFATHNA
LTLCLILQMTAAAGIAPGSGRFEFQCLHGMGEALYDRVLAAKAAGPVPSGLVCRIYAPVG
RHETLLPYLVRRLLENGANSSFVRRIVDASVEIDHLLEDPFATARQSEGAPHPAIPLPAH
ITAPRRNASGIDLHDPGAAAAQRAAIDRAVEHTGIYEVEAILARVPATAGAEAHGEAAVA
ASDVPGRRTIRNPARHDEIVGTVRDADATEIDAAFAAAVDSVWLKTEPGERAAILEAAAD
ALESCRDEFLALAIREAGKTLGAAIAEVREAVDACRYYAQQLHSTDAGSTGSPVGTVVAI
SPWNFPLAIFVGQVAAALAAGNPVLAKPAEQTPLIAARAVQCLHAAGVPRSALQLLPGDG
AVGAMLVRDVRVHGVLFTGSTDTAQDVDRAVATLPTHRDRILIAETGGLNAMIVDASAQS
EQVVLDALRSAFDSAGQRCSALRILCLQEEIAEPMLEMLIGAAAELRVGDPAALATDIGP
VIDGSARAALDTHLGSFPANRVLARIPLSPECAEGSFFSPAIVAIESVDELAREAFGPIL
HVLRYRRADLETLVDALNATGYALTCGIQSRVDETVAAIAAGIEAGNVYANRNMIGAAIG
MQPFGGHGLSGTGPKMGGPWIVRRLRREAAAPVDAANPQSCIARWGAHRESGAPAALHDF
QRWLSTDGRHELAQICAEYAACTPIGCRVDLPAPTGESNLLRYRPLGRILCLGSGHRLAG
RGVLAQLAAVLATDNRALLLADARSRAVLSGIPASVWMNIDWVEDWGREPFEAALFEGDD
GRTHNLRWLLARRPGRRIALVRPSAEERYALDRLVTEQTITVNTAAAGGNAALMSLSGDG
T
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttacctttcccggaatcttccctgcccgcactgcgcgcgcggatccgcgcc
gccgccctccgcccggaggcggaatgcgttgccgaactcctgcagcgcaaccccctgtcc
gccacccagattgcggcagcgcgcggaccggcgcaggcgctgatccgggccctgcgcgcc
cagcgcagccatgcccacggcgtcgacgccatgatgcgcgagttttccctgtccagccag
gaaggcgtcgcgctgctgtgtctggccgagtcgctgctgcgcattccggacgccgccacc
gccgacgcgctgatccgcgacaagctcgcccgcggcgactggcgtgcgcacatcgggccc
agccgctcggtctttctcaacgccgccgcctggggcctgctgctcaccggcaagctttcg
gccacccatagcgaaaccggcctgaccgccgccgtcacccgggcgattgcgcgcggaggc
gaacccctggtccgcgccgcgatcgataccgcgatgcgcatgctgggggaacagttcgtt
ctggggaagacgatcgaccaggcgctggcgcgggcccgctccgccaggggacgcggctac
cgccattcgtacgacatgctcggtgaggcggcgctcaccgccgccgaggcgaagcgctat
ttcgacgcctatgccggcgcgatcgccgccatcgccgccgccgaaccggtggctgatgcc
gcagcggcaccgatgcacccggaagatcggcttcggcgtcgtgccagcgtctcggtcaag
ctttcggcactccacccccggttcgaatcccttcaggaagaccgggtccggcgggagttg
ctgccgcggatccgcgaactctgccggctggcccgcaagcacgggcttgcactcgatctc
gacgccgaggaaggcgagcggctggaaccgctgctcgacatcgtcgaagcgctcgcgttc
gatccggccctcgcggactggagcggcctcggcatcgcggtgcaggcctaccagaagcgc
gccctgccggtgatcgactggctggcggcactggcgcgggaaagcggccggcgcatcggc
gtgcggctggtcaagggtgcctactgggaccgcgagatcaagcgcacgcaggtggaaggg
ctggcggactacccggtctatacgcgcaaggcgcacaccgatgccgcctatctggtctgc
gcccgacgtctgctcgaccatggcgaccatctgttcccccaattcgccacgcacaacgcg
ctgaccttgtgcctgatcctgcaaatgacggcggcggcgggcatcgcccccggttcgggt
cggttcgagttccaatgcctgcacggcatgggagaagccctctacgaccgcgtgctcgcc
gccaaggcggcgggaccggtaccgtccggcctcgtctgccggatctacgcgcccgtggga
cggcacgagaccctgctgccctatctcgtccggcggctgctggaaaacggcgccaactcc
tccttcgtgcggcggatcgtcgacgccagcgtcgaaatcgaccacctgctggaggacccc
ttcgccaccgcgcggcagtccgaaggcgccccccacccggcgattcccctgccggcgcac
atcaccgcgccgcggcgcaacgccagcggcatcgatctgcatgaccccggcgccgcggcg
gcgcagcgcgcggccatcgaccgggcggtcgagcacaccggaatctacgaggtcgaggcg
atcctcgcgcgcgttccggcgaccgcgggcgcggaagcgcacggcgaagcggcggttgcc
gcctccgacgtgccggggcgccggacgatccgcaatccggcgcggcacgacgagatcgtc
ggaacggtgcgcgacgcggacgccaccgagatcgatgccgcgttcgctgcggcagtggac
agcgtctggctcaagaccgagcccggcgaacgtgccgccatcctggaggcagcagccgac
gcgctcgagtcctgccgggacgagtttctggcgctcgccatccgggaggccgggaagacg
ctcggtgcggcgatcgccgaagtgcgcgaagcggtcgacgcctgccgctactacgcccag
cagctccatagcaccgatgctggctcgacgggctcgccggtcggcacggtggtcgcgatc
tcgccatggaatttcccgctcgccatcttcgtcgggcaggtggccgcggccctcgcggcg
ggcaacccggtcctggccaagccggcggaacagaccccgctgatcgccgcgcgggcggtg
cagtgcctgcatgccgccggcgtgccgcgaagcgcgctgcagctgctgcccggggacggc
gcggtcggcgccatgctggtgcgggacgtgcgggtgcatggggtcctgttcaccggctcg
acggatacggcacaggacgtggaccgcgcggtcgccaccctgcccacccaccgggaccgg
atcctcatcgccgaaaccggagggctgaacgcgatgatcgtcgacgccagcgcgcagtcg
gaacaggttgtcctggacgcgctgcgttcggccttcgacagcgcagggcagcgctgttcc
gccctgcgcatcctgtgcctgcaggaggagatcgccgagccgatgctcgaaatgctgatc
ggcgccgcggccgaactgcgcgtcggcgatcccgccgccctcgccaccgacatcggtccg
gtgatcgacgggtcggcacgcgcggcgctcgacacccacctggggtcgttccccgccaac
cgcgttctcgcgcgcattccgctgtcgcccgagtgcgccgaaggaagctttttctcgccg
gccatcgtcgcgatcgaatcggtcgacgaattggcgcgcgaggcgttcgggccgatcctg
cacgtgctgcgataccggcgggcggatctcgagaccctcgtcgacgcactcaacgccacc
ggatacgcgctgacctgcggcatccagagccgtgtcgatgagaccgtggcggcgatcgcc
gccggcatcgaggccggcaacgtctacgccaaccgcaacatgatcggcgccgcgatcggc
atgcagccgttcggcggccatgggttgtccggaaccggccccaagatgggcggcccgtgg
atcgtccggcgcctgcggcgcgaagcggccgcaccggtcgacgccgcgaatccgcaatcc
tgcatcgcgcggtggggcgcgcatcgggagtcgggggctccggccgcgctgcacgacttt
cagcgctggctgtcgacggacgggcgccatgaactggcacagatctgcgccgaatacgct
gcctgcacaccgatcggctgccgcgtcgacctgcctgcaccgaccggggaaagcaacctg
ctgcgctaccgtcccctgggccgcatcctctgcctcggctccgggcatcgcctcgcaggc
cgcggcgtcctggcgcaactcgcggccgtgctggcgacggacaatcgcgcgctgctgctc
gcggatgcgcgctcccgggccgtgctctccggaattcccgcgtcagtctggatgaacatc
gactgggtggaggactgggggcgcgaaccgttcgaggcggccctgttcgaaggcgacgac
gggcgcacccacaacctgcgctggctgctcgcgcggcgcccgggccggcggatcgcgctg
gtgcgaccgagcgccgaggaacgctacgcgctcgatcgactggtgacggaacagaccatc
acggtgaacaccgccgcggccggagggaatgccgccctgatgagtctttccggggatgga
acgtag

DBGET integrated database retrieval system