KEGG   Burkholderiales bacterium GJ-E10: E1O_01160Help
Entry
E1O_01160         CDS       T03654                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00450  Selenocompound metabolism
bbag00970  Aminoacyl-tRNA biosynthesis
bbag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E1O_01160
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E1O_01160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbag01007]
    E1O_01160
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbag03016]
    E1O_01160
Enzymes [BR:bbag01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     E1O_01160
Amino acid related enzymes [BR:bbag01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   E1O_01160
Transfer RNA biogenesis [BR:bbag03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    E1O_01160
 Prokaryotic type
   Other AARSs
    E1O_01160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1f tRNA-synt_1e SAP130_C
Motif
Other DBs
NCBI-ProteinID: BAP87247
UniProt: A0A0A1H3L0
Position
complement(120217..122376)
Genome map
AA seq 719 aa AA seqDB search
MTHRELFVTTALPYANGPLHIGHVMEYIQADIWVRYQRLRGATVHFVGADDAHGAPIMIA
AEKAGKTPQQYVAEIAASRRQYLDGFFLSFDHWHSTDSAENTELSQEIYRRLRAKELIAT
RIIEQFYDPVKGMFLPDRYIRGECPRCGAADQYGDSCEVCGAVYAPTELKHPRSALSGAT
PELRASEHHFFRLSDIRCREFLRGWIQGGRLQPEVANKAREWLDGERELADWDISRDAPY
FGIPIPDAPGKYFYVWLDAPIGYLASLKAYCARRGLDFEAVLRNPRTEQIHFIGKDIIYF
HTLFWPAMLEFAGPPFKVPDRVNVHGFITVSGEKMSKSRGTGIDPLRYLALGMNPEWLRY
YIAAKLNAHVEDVDFNPDDFLQRVNSDLIGKYVNIASRAATFLTRHFDGQAANLQNAAGP
LLHILRHQPETLGQEIAQAYEDREFGRAIRLAMAYADEVNAYFDAAKPWELAKKLGQGSA
DDDDAQRLQEICSVTLRGFQYLTLWLKPVLPRLAEEAEAFLRCGAMRWESGSALPPLERI
TPYRHLMARVEEKQIDALFALPALAGGAGATPTTATPTKEPKVSSSENSPAQAPANGTAA
QQPAAPAPISIDDFGKIELRIARIVNAEPVEGAEKLLRLTVDIGEERPRNVFAGIKSAYQ
PEQLIGKLTVVVANLAPRKMKFGVSEAMILAASHENQKEHPGLFLLEPHAGAQPGMRVR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcgagaactcttcgtcaccacggcgctgccgtacgccaacgggccgctgcac
atcggccacgtcatggagtacatccaggccgacatctgggtccggtaccagcggctgcgg
ggcgcgaccgtgcatttcgtcggcgccgacgacgcacatggcgcgccgatcatgatcgcc
gcggaaaaagccggcaagacgccacagcagtacgtcgcggagatcgccgcatcgcgccgc
caatacctcgacgggttctttctttccttcgatcactggcattccaccgactcggcggag
aacacggagttgtcgcaggagatctaccgccggttgcgcgccaaggagctgatcgccacc
cgcatcatcgagcagttctacgacccggtgaagggcatgttcctgccggaccgctacatc
cgcggcgaatgcccgcgctgcggcgcggccgaccagtacggcgactcctgcgaagtctgc
ggcgcggtctacgccccgaccgaactcaagcacccccgctcggcgctctcgggcgccacg
cccgaactgcgggcatccgagcatcatttcttccgcctctccgacatccgctgccgcgaa
ttcctgcgcggctggatccagggcggccggctgcagccggaggtggcgaacaaggcgcgg
gaatggctcgacggcgaacgggaactcgccgactgggacatttcgcgcgatgcgccctac
ttcggcattccgatcccggatgcgcccggcaagtacttctacgtctggctggatgcgcca
atcggatatctcgcctcgctcaaggcgtactgcgcccgccgggggctggatttcgaagcc
gtgctgcgcaacccgcgcaccgagcagatccacttcatcggcaaggacatcatctatttc
cacaccctgttctggccggcaatgctggaattcgcagggccgccgttcaaggtgccggat
cgcgtgaacgtccacggattcatcaccgtgagcggcgaaaagatgtcgaagagccggggt
accggcatcgacccgctgcgctatctcgcgctcggcatgaatccggaatggctgcgctac
tacatcgccgccaagttgaacgcccacgtcgaggacgtcgacttcaaccccgacgatttc
ctccagcgggtcaacagcgacctgatcggcaagtacgtcaacatcgccagccgcgcggcg
acgttcctcacccggcacttcgacggtcaggccgcgaatttgcagaacgcggccggcccc
ctcctgcacatcctccggcatcaaccggaaacgctcggccaggaaatcgcccaggcgtac
gaggatcgcgagttcggccgggccatacgcctcgcaatggcctacgccgacgaggtcaac
gcgtacttcgatgcggcgaagccctgggaactggcgaagaagctgggccagggaagcgcc
gacgacgacgatgcacagcggttgcaggagatctgctccgtcaccctgcgcggattccag
tacctgacgctctggctcaagccggtgctgccacggctggcggaagaagccgaagccttc
ctccgctgcggcgcgatgcgctgggaatccggatcggccctgcccccgctcgaacgaatc
accccctaccggcacctgatggcgcgggtggaggaaaagcagatcgatgcgctgttcgcg
cttcccgcgctcgcgggcggtgccggcgcgaccccgacaaccgcaacccctacgaaggaa
ccgaaggtgtcttcttccgaaaattcaccggcccaggcgcccgccaacggcactgccgcg
cagcaaccggccgccccggcgcccatctccatcgacgatttcggcaagatcgagctgcgc
atcgcgcgcatcgtcaacgccgaaccggtcgaaggtgcggagaagctgctacgcctgacg
gtggacatcggcgaggagcgaccccgcaatgtctttgccggcatcaagtccgcctaccag
cccgagcaactgatcggcaagctgaccgtggtcgtcgccaatctggcgccccgcaagatg
aagttcggtgtcagcgaagcgatgattctcgcggccagtcacgaaaaccagaaggagcat
cccggactcttcctgctggagccgcatgccggtgcccagccggggatgcgggtacgatag

DBGET integrated database retrieval system