KEGG   Burkholderiales bacterium GJ-E10: E1O_07130Help
Entry
E1O_07130         CDS       T03654                                 

Definition
(GenBank) acetolactate synthase 3 catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00290  Valine, leucine and isoleucine biosynthesis
bbag00650  Butanoate metabolism
bbag00660  C5-Branched dibasic acid metabolism
bbag00770  Pantothenate and CoA biosynthesis
bbag01100  Metabolic pathways
bbag01110  Biosynthesis of secondary metabolites
bbag01130  Biosynthesis of antibiotics
bbag01210  2-Oxocarboxylic acid metabolism
bbag01230  Biosynthesis of amino acids
Module
bbag_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bbag_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    E1O_07130
   00660 C5-Branched dibasic acid metabolism
    E1O_07130
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    E1O_07130
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    E1O_07130
Enzymes [BR:bbag01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     E1O_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N
Motif
Other DBs
NCBI-ProteinID: BAP87844
UniProt: A0A0A1H3J2
Position
753355..755145
Genome map
AA seq 596 aa AA seqDB search
MRSVVPESAPAASLSPATAAAAVPSPETDLLTGAEILVRCLREEGVRHVFGYPGGAVLYI
YDAIFKQDSFQHILVRHEQAAVHAADAYSRSSRKVGVAIVTSGPGATNAVTGIATAYMDS
IPLVIISGQVPTHAIGQDAFQECDTVGITRPCVKHNFLVKNVADLAPTIRKAFHIAQTGR
PGPVLVDVPKDITIARHAFSYPRDLHLRSYNPVVKGHMGQIKKAVQLLLAAERPLIYTGG
GVILANATEELGRLVDRLGFPCTSTLMGLGGYPASDKKFLGMLGMHGTIEANFAMQHCDV
LLAVGARFDDRVIGSPAHFAQNPRKIIHIDIDPSSISKRVKVDVPIVGDVREVLAEILAQ
VDAAGGRAAAIDAWWDQLGTWRSQDCLRYERSETVVKPQHVVETLWNLTGGDIFVTSDVG
QHQMWAAQYYRFDKPRRWINSGGLGTMGVGLPYAMGVQMANPGAQVAVITGEGSIQMNIQ
ELSTCRQYRLTPKIINLNNRYLGMVRQWQQIEYGSRYSESYMDALPDFVRLAEAYGHVGM
RIDKPADVEPALREAFTTYRDRLVFLDFITDSSENVWPMVRAGKGLTEMMLGAEEL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccgttgtgccggaatcggcgcctgccgcttccttatcccccgcgactgccgcg
gccgccgtcccgtcccccgaaaccgatctgctgaccggcgccgagatcctcgtccgctgc
ctgcgcgaggaaggggtgcgccatgtgttcggctatccgggcggcgcggtgctgtatatc
tacgacgcgattttcaagcaggattccttccagcacatcctggtgcgccacgagcaggcg
gcggtccatgcggccgatgcgtattcgcggtcgagccgcaaggtcggcgtggcgatcgtc
accagcggccccggtgcgaccaatgcggtcaccggcattgccacggcatacatggattcg
atcccgctggtcatcatcagcggtcaggtgccgacccacgcgatcggccaggacgcattc
caggagtgcgataccgtcggcatcacgcggccctgcgtcaagcacaatttcctggtcaag
aacgtcgccgacctggcgccgacgatccgcaaggcgttccacatcgcccagaccgggcgt
cccggccccgtcctggtcgacgtccccaaggacatcaccatcgcgcggcatgcgttctcg
tatccgcgcgatttgcatctgcgttcctacaatccggtggtcaagggccacatgggccag
atcaagaaggcggtgcaactgctgctggccgccgagcggccgctcatctacaccggcggc
ggcgtgatcctcgcgaatgccacggaggaactcgggcgcctcgtcgaccgcctgggattt
ccgtgcaccagcaccctcatggggttgggcggctatccggcctcggacaagaagttcctt
ggcatgctgggcatgcacgggacgatcgaggcgaattttgcgatgcagcattgcgacgtg
ctgcttgcggtgggggcgcggttcgacgaccgggtgatcggcagtcccgcacatttcgcc
cagaacccgcgcaagatcatccatatcgacatcgatccgtcgtcgatctccaagcgcgtc
aaggtcgacgtgccgatcgtcggcgatgtgcgcgaggtgcttgcggaaatcctggcccag
gtcgatgcggcgggcggccgcgcggccgcgatcgacgcctggtgggaccagctgggtaca
tggcggtcccaggactgcctgcgctacgagcgcagcgagacggtggtcaaaccccagcat
gtcgtcgagaccctctggaacctgacgggcggcgacatcttcgtcacgtccgacgtcggg
cagcaccagatgtgggcggcgcagtattaccggttcgacaagccgcggcggtggatcaac
tccggcggcctggggacgatgggcgtcggccttccctacgcgatgggtgtgcagatggcc
aatcccggggcccaggttgcggtgatcaccggcgagggctcgatccagatgaacatccag
gagctgtcgacctgcaggcagtatcgcctgacgcccaagatcatcaatctgaacaatcgc
tacctcggcatggtgcggcaatggcagcagatcgagtacggcagccgctattcggaatcg
tacatggatgcgctgccggatttcgtgcgtctggccgaggcgtacgggcacgtcggcatg
cggatcgacaagccggccgatgtcgagcccgcgctgcgcgaggcgttcacgacctaccgc
gaccggctggtcttcctggatttcatcaccgattcgagcgaaaacgtctggcccatggtg
cgtgcgggcaaaggactgaccgagatgatgctcggcgcggaggaactgtga

DBGET integrated database retrieval system