KEGG   Burkholderiales bacterium GJ-E10: E1O_09890Help
Entry
E1O_09890         CDS       T03654                                 

Definition
(GenBank) stationary phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
bbag  Burkholderiales bacterium GJ-E10
Pathway
bbag00230  Purine metabolism
bbag00240  Pyrimidine metabolism
bbag00760  Nicotinate and nicotinamide metabolism
bbag01100  Metabolic pathways
bbag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbag00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    E1O_09890
   00240 Pyrimidine metabolism
    E1O_09890
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    E1O_09890
Enzymes [BR:bbag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     E1O_09890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: BAP88120
UniProt: A0A0A1H4F8
Position
1085975..1086718
Genome map
AA seq 247 aa AA seqDB search
MHILISNDDGYLAPGLAALVDAVRRFGDITVVAPEQNCSGASNSLTLSRPLSVRSAENGF
RFVNGTPTDCVHIALTGLLDRVPDLVLSGINDGQNMGDDTVYSGTVAAAMEGYLFGIPSI
AFSRAEKGRTNWEAAGQVAAGVVERFLDRPLEGPFLLNVNIPNIAAEEMGPIRCTRLGKR
HKAEPVIRQTSPRGETIYWVGAAGEARDAGPGTDFHAIAQGCVSVTPLQIDLTHVQQMDA
VARWLAP
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacattttgatctccaacgatgacggataccttgcgcccggtcttgcagcgctggtc
gatgccgtccgccgcttcggcgatatcaccgtggtcgcccccgaacagaactgcagcggg
gcgagcaactccctgaccttgagccggccgctcagcgtgcgcagcgccgagaacggcttc
cggttcgtcaacggcacgcccaccgactgtgtccacatcgcactgaccggtctgctcgac
cgggttccggatctggtgctgtcgggcatcaatgacggtcagaacatgggcgacgacacg
gtctactccggcaccgtggcggcggcgatggagggctacctgttcgggattccgtccatt
gccttttcccgggcggaaaaggggcgcacgaactgggaggccgccggtcaggtggccgcc
ggggtcgtcgagcgctttctcgaccgccccctggaagggccgttcctgctcaacgtcaat
attccgaacatcgcggcggaggagatggggccgatccgctgcacccgcctgggcaagcgc
cacaaggccgaaccggtgatccgccagacgagtccgcgcggcgagacgatctactgggtg
ggcgcggcgggcgaggcccgcgacgccggtcccggcaccgatttccatgcgatcgcgcaa
gggtgcgtgtcggtgacgccgctgcagatcgatctcacccacgtgcaacagatggacgcc
gttgcgcggtggctcgccccgtga

DBGET integrated database retrieval system